DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and Stt3b

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001164010.1 Gene:Stt3b / 363160 RGDID:1311563 Length:824 Species:Rattus norvegicus

Alignment Length:726 Identity:429/727 (59%)
Similarity:532/727 (73%) Gaps:25/727 (3%)


  Fly     7 GVARGLLTWDKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYK 71
            |::.||......:.|:...||.||.:..|::|||:|:||||:||||||:||||:|..||..|||:
  Rat    55 GLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFYE 119

  Fly    72 FHNWFDDRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTY 136
            |.||||:|||||||||:|||:|||||:|:..::.::..||:|:.||:|||||||.||.||::.|:
  Rat   120 FLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTF 184

  Fly   137 ALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAM 201
            .||:|:.:.||||:||..|:|||||||||||||:||||||||.:.||||||:|:||||::||:..
  Rat   185 LLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMC 249

  Fly   202 SALAYFYMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPI 266
            ..|:||||||:||||||:||||||||..|::..|:|.|:||||||.|.||.||||||.|||||||
  Rat   250 CCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPI 314

  Fly   267 QSSEHMLALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWT 331
            ::||||.|.|.|.|.|.:||:.|||.|:.|..|..||...||.....||:....||.||.::||:
  Rat   315 RTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWS 379

  Fly   332 GRFYSLLDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILY 396
            ||||||.|..|||.||||||||||||||:|.||:|||.|||..|||||:||...:.|..:|:.||
  Rat   380 GRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALY 444

  Fly   397 GVTSIYFAGVMVRLMLVLAPVMCVLSGIAIS----HLLAKYIKSVDAGSSSKQGVESKRQHKKLE 457
            .::::|||||||||||.|.||:|:||.||.|    |.|...:|..:.........:.:|....|.
  Rat   445 AISAVYFAGVMVRLMLTLTPVVCMLSAIAFSSVFEHYLGDDMKRENPPVEDSSDEDDRRSPGNLY 509

  Fly   458 QQTGGV--------KSEVAIG-----FVGVITLMLI-VYTLHCTWVTSEAYSSPSIVLSARSHDG 508
            .:.|.|        |.|..:|     .|.::.|||: ::.:|||||||.||||||:||::.:|||
  Rat   510 DKAGKVRKHVTEQEKPEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDG 574

  Fly   509 GRIIFDDFREAYYWLQMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASS 573
            .|.|.|||||||:||:.||.|.||:||||||||||..|||||.|||||||||:||:.||:||:|:
  Rat   575 TRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSN 639

  Fly   574 EEKAYEIMRELDVDYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGAH---IREKDYYAANGEF 635
            |..||:|||.||||||||||||:.|||.||||||||||||.    .|.|   |||.||:...|||
  Rat   640 ETAAYKIMRSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIA----EGEHPKDIREGDYFTQQGEF 700

  Fly   636 RVDKEGSPTLLNCLMYKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLV 700
            |||:.|||||||||||||.|||||:|..:.....|:||.|.|||||||.:...:|||:|:|||||
  Rat   701 RVDRAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLV 765

  Fly   701 RIYKVKDLPNR 711
            ||||||...||
  Rat   766 RIYKVKAPDNR 776

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 426/715 (60%)
STT3 21..495 CDD:280649 277/492 (56%)
Stt3bNP_001164010.1 Stt3 68..807 CDD:224206 426/714 (60%)
STT3 69..561 CDD:280649 277/492 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D111618at33208
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126840
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.