DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and stt3b

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001315090.1 Gene:stt3b / 323918 ZFINID:ZDB-GENE-030131-2638 Length:805 Species:Danio rerio

Alignment Length:727 Identity:429/728 (59%)
Similarity:535/728 (73%) Gaps:25/728 (3%)


  Fly     6 GGVARGLLTWDKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFY 70
            ||::.||......:.|:...||.||.:..|::|||:|:||||:||||||:||||:|..|...|||
Zfish    37 GGLSGGLTQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLTTNGFY 101

  Fly    71 KFHNWFDDRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVT 135
            :|.||||:|||||||||:|||:|||||:|:..::.::.||:||:.||:|||||||.||.||.:.|
Zfish   102 EFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYVLNLLHVTVHIRDVCVFLAPVFSGLTAIST 166

  Fly   136 YALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSA 200
            :.||:|:.:.||||:||..|:|||||||||||||:||||||||.:.||||||:|:||||::||:.
Zfish   167 FLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWAI 231

  Fly   201 MSALAYFYMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQP 265
            ...|:||||||:||||||:||||||||..|::..|:|.|:||||||.|.||.:|||||.||||||
Zfish   232 GCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSRRLYIAYSTFYIVGLVLSMQIPFVGFQP 296

  Fly   266 IQSSEHMLALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPW 330
            |::||||.|.|.|.|.|.:||:.||:.|:.:..|..||...||....|||:....||.||.::||
Zfish   297 IRTSEHMAAAGVFALLQAYAFLQYLKDRLTRQEFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPW 361

  Fly   331 TGRFYSLLDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIIL 395
            :||||||.|..|||.||||||||||||||:|.||:|||.|||..|||||:||...:.|..:|:.|
Zfish   362 SGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVAL 426

  Fly   396 YGVTSIYFAGVMVRLMLVLAPVMCVLSGIAIS----HLLAKYIKSVDAGSSSKQGVESKRQHKKL 456
            |.::::|||||||||||.|.||:|:||.||.|    |.|...:|..:..:......:.||....|
Zfish   427 YAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSSVFEHYLGDDLKRENPPAEDSSDEDDKRNQGNL 491

  Fly   457 EQQTGGVKSEVA--------IG-----FVGVITLMLI-VYTLHCTWVTSEAYSSPSIVLSARSHD 507
            ..:.|.|:..|:        :|     .|.::.|||: ::.:|||||||.||||||:||::.:||
Zfish   492 YDKAGKVRKHVSEQDRPEEGLGPNIRSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHD 556

  Fly   508 GGRIIFDDFREAYYWLQMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMAS 572
            |.|.|.||||||||||:.||.|.||:||||||||||..|||||.|||||||||:||:.||:||:|
Zfish   557 GSRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSS 621

  Fly   573 SEEKAYEIMRELDVDYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGAH---IREKDYYAANGE 634
            :|..|||||:.|||||||:||||:.|||.||||||||||||.    .|.|   |||.||:...||
Zfish   622 NESAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIA----EGEHPKDIRESDYFTPQGE 682

  Fly   635 FRVDKEGSPTLLNCLMYKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWL 699
            |||||.|||||||||||||.|||||:|..:.....|:||.|.|||||||..|..:|||:|:||||
Zfish   683 FRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIRLKHLEEAFTSEHWL 747

  Fly   700 VRIYKVKDLPNR 711
            ||||:||...||
Zfish   748 VRIYRVKKQENR 759

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 425/715 (59%)
STT3 21..495 CDD:280649 275/492 (56%)
stt3bNP_001315090.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D111618at33208
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1409
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.