DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and stt3a

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_958866.1 Gene:stt3a / 266797 ZFINID:ZDB-GENE-021015-3 Length:705 Species:Danio rerio

Alignment Length:701 Identity:540/702 (77%)
Similarity:615/702 (88%) Gaps:7/702 (1%)


  Fly    13 LTWDKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFD 77
            |:::||:.|:||.||.:||||||:||||||||||||||||||||||||||||||:||||||||||
Zfish     9 LSYEKQDTLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFD 73

  Fly    78 DRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALTKEI 142
            ||||||||||||||||||||:||||||.::...::|||||||||||||.|||.|.:|||..|||:
Zfish    74 DRAWYPLGRIIGGTIYPGLMITSAALYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTKEL 138

  Fly   143 HSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAMSALAYF 207
            ...||||:|||:|::||||||||||||||||||||||||.|||:||||||:|:|:||:|.|||||
Zfish   139 KDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKSGSIYWSSMCALAYF 203

  Fly   208 YMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPIQSSEHM 272
            |||||||||||||||||||||.||:|||||||||:||.|:||:|||||||||||||||:||||||
Zfish   204 YMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVQSSEHM 268

  Fly   273 LALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWTGRFYSL 337
            .|.|.|||||||||||||||::....|::||::::|.|..::..||.||.||||:||||||||||
Zfish   269 AAFGVFGLCQIHAFVDYLRSKLNAQQFEVLFRSVISLVGIILLSVGGLLMLTGKISPWTGRFYSL 333

  Fly   338 LDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILYGVTSIY 402
            ||||||||:|||||||||||||:|||:|||||:|||:||.|||:||:.|:|:.||||:|||||:|
Zfish   334 LDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFNNLSDATIFIIMYGVTSMY 398

  Fly   403 FAGVMVRLMLVLAPVMCVLSGIAISHLLAKYIKSVDAGSSSKQGVESKRQHKKLEQQTGGVKSEV 467
            |:.||||||||||||||:||||.:|.:|..::|::|.....|       :.||.:..|..:|:||
Zfish   399 FSAVMVRLMLVLAPVMCILSGIGVSQVLTTFMKNLDVSRPDK-------KTKKQQDSTYPIKNEV 456

  Fly   468 AIGFVGVITLMLIVYTLHCTWVTSEAYSSPSIVLSARSHDGGRIIFDDFREAYYWLQMNTPEDAR 532
            |.|.:.|:...||.||.|.||||||||||||||||||..||.||||||||||||||:.||||||:
Zfish   457 ASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAK 521

  Fly   533 IMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLT 597
            :|||||||||||||||||||||||||||||||||||||||:|||||||||||||.||||||||||
Zfish   522 VMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLT 586

  Fly   598 GYSSDDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQMY 662
            |||||||||||||||||||||.|.||:|.|||...||||||:||||.||||||||||||||||:|
Zfish   587 GYSSDDINKFLWMVRIGGSTDTGRHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVY 651

  Fly   663 TEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVKDLPNRGV 713
            ||..:..||||||.||||||||||||:|||||||||||||||||||.|||:
Zfish   652 TEAKRPPGYDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGL 702

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 536/693 (77%)
STT3 21..495 CDD:280649 346/474 (73%)
stt3aNP_958866.1 Stt3 16..701 CDD:224206 536/692 (77%)
STT3 17..484 CDD:280649 346/474 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153566739
eggNOG 1 0.900 E1_COG1287
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H40617
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D111618at33208
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126840
Panther 1 1.100 LDO PTHR13872
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.