DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and stt3

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_595148.1 Gene:stt3 / 2540190 PomBaseID:SPBC1271.02 Length:752 Species:Schizosaccharomyces pombe

Alignment Length:706 Identity:365/707 (52%)
Similarity:501/707 (71%) Gaps:34/707 (5%)


  Fly    22 VKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDRAWYPLGR 86
            :|:.|||..||.|.::|||||:|:||:||||||:||:|.::.|.|||||.|.||||:|:||||||
pombe    24 LKVLILICIAVASVSSRLFSVIRYESIIHEFDPWFNFRASKILVEQGFYNFLNWFDERSWYPLGR 88

  Fly    87 IIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALTKEIHSTGAGLVA 151
            :.|||:|||||:||..:::::.||.:.::||:|||.|||.||.:|.:.||.|.:|:.|...||:|
pombe    89 VAGGTLYPGLMVTSGIIFKVLHLLRINVNIRDVCVLLAPAFSGITAIATYYLARELKSDACGLLA 153

  Fly   152 AALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAMSALAYFYMVSSWGGY 216
            ||.:.|.|||.|||||||||||.|||..::.|:.|||||||:|:.||.|.:.|.|||||::||||
pombe   154 AAFMGIAPGYTSRSVAGSYDNEAIAITLLMSTFALWIKAVKSGSSFWGACTGLLYFYMVTAWGGY 218

  Fly   217 VFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPIQSSEHMLALGTFGLC 281
            ||:.|:|||||..|::.||::.::||||:|.|.:||:.|||:.||||||:.:||||.|||.|||.
pombe   219 VFITNMIPLHVFVLLLMGRYTSKLYIAYTTYYVIGTLASMQVPFVGFQPVSTSEHMSALGVFGLL 283

  Fly   282 QIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWTGRFYSLLDPSYAKNH 346
            |:.||.:|::..:....|.:|.:..:..::.:..||...|:.||.::|||||||||.|.:|||.|
pombe   284 QLFAFYNYVKGLVSSKQFQILIRFALVCLVGLATVVLFALSSTGVIAPWTGRFYSLWDTNYAKIH 348

  Fly   347 IPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILYGVTSIYFAGVMVRLM 411
            ||||||||||||.:|||.:||||.|::|.|.|:|.||.:|.:.::|||:|.|...||.||||||:
pombe   349 IPIIASVSEHQPPTWSSLFFDLQFLIWLLPVGVYLCFKELRNEHVFIIIYSVLGTYFCGVMVRLV 413

  Fly   412 LVLAPVMCVLSGIAISHLLAKYI-KSVDAGSSSKQGVESKRQHKK-----LEQQTGGVKSEVAIG 470
            |.|.|.:|:.:.:|||.||..|: ..|:....|::...:|.::||     |...|.|.|:     
pombe   414 LTLTPCVCIAAAVAISTLLDTYMGPEVEEDKVSEEAASAKSKNKKGIFSILSFFTSGSKN----- 473

  Fly   471 FVGVITLM------------LIVYTLHCTWVTSEAYSSPSIVLSARSHDGGRIIFDDFREAYYWL 523
             :|:.:|:            ||::..|.:||||.|||||::|||...:||..:..|||||||.||
pombe   474 -IGIYSLLSRVLVISSTAYFLIMFVYHSSWVTSNAYSSPTVVLSTVLNDGSLMYIDDFREAYDWL 537

  Fly   524 QMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDY 588
            :.|||.|.::||||||||||..||:|..||||||||||||:.||:||:|.|||||.|:|:.||||
pombe   538 RRNTPYDTKVMSWWDYGYQIAGMADRITLVDNNTWNNTHIATVGKAMSSPEEKAYPILRKHDVDY 602

  Fly   589 VLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGA---HIREKDYYAANGEFRVDKEGSPTLLNCLM 650
            :|:|:||..||||||:||||||:||    .:|.   .|.|::::..|||:|.|...:||:...|:
pombe   603 ILIIYGGTLGYSSDDMNKFLWMIRI----SQGLWPDEIVERNFFTPNGEYRTDDAATPTMRESLL 663

  Fly   651 YKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVK 706
            |||.|:...:::...   |||||.|..::.:||.:|..:|||:||.|.|||:||||
pombe   664 YKMSYHGAWKLFPPN---QGYDRARNQKLPSKDPQLFTIEEAFTTVHHLVRLYKVK 716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 365/707 (52%)
STT3 21..495 CDD:280649 248/491 (51%)
stt3NP_595148.1 Stt3 6..750 CDD:224206 365/707 (52%)
STT3 23..509 CDD:280649 248/491 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 787 1.000 Inparanoid score I72
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 1 1.000 T631742
orthoMCL 1 0.900 OOG5_126840
Panther 1 1.100 O PTHR13872
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1409
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.