DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and STT3B

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_849193.1 Gene:STT3B / 201595 HGNCID:30611 Length:826 Species:Homo sapiens

Alignment Length:726 Identity:430/727 (59%)
Similarity:534/727 (73%) Gaps:25/727 (3%)


  Fly     7 GVARGLLTWDKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYK 71
            |::.||......:.|:...||.||.:..|::|||:|:||||:||||||:||||:|..||..|||:
Human    57 GLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFYE 121

  Fly    72 FHNWFDDRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTY 136
            |.||||:|||||||||:|||:|||||:|:..::.::..||:|:.||:|||||||.||.||::.|:
Human   122 FLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTF 186

  Fly   137 ALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAM 201
            .||:|:.:.||||:||..|:|||||||||||||:||||||||.:.||||||:|:||||::||:..
Human   187 LLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMC 251

  Fly   202 SALAYFYMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPI 266
            ..|:||||||:||||||:||||||||..|::..|:|.|:||||||.|.||.||||||.|||||||
Human   252 CCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPI 316

  Fly   267 QSSEHMLALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWT 331
            ::||||.|.|.|.|.|.:||:.|||.|:.|..|..||...||.....||:....||.||.::||:
Human   317 RTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWS 381

  Fly   332 GRFYSLLDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILY 396
            ||||||.|..|||.||||||||||||||:|.||:|||.|||..|||||:||...:.|..:|:.||
Human   382 GRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALY 446

  Fly   397 GVTSIYFAGVMVRLMLVLAPVMCVLSGIAISHLLAKYI----KSVDAGSSSKQGVESKRQHKKLE 457
            .::::|||||||||||.|.||:|:||.||.|::...|:    |..:.........:.||....|.
Human   447 AISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEDDKRNQGNLY 511

  Fly   458 QQTGGV--------KSEVAIG-----FVGVITLMLI-VYTLHCTWVTSEAYSSPSIVLSARSHDG 508
            .:.|.|        |:|..:|     .|.::.|||: ::.:|||||||.||||||:||::.:|||
Human   512 DKAGKVRKHATEQEKTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDG 576

  Fly   509 GRIIFDDFREAYYWLQMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASS 573
            .|.|.|||||||:||:.||.|.||:||||||||||..|||||.|||||||||:||:.||:||:|:
Human   577 TRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSN 641

  Fly   574 EEKAYEIMRELDVDYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGAH---IREKDYYAANGEF 635
            |..||:|||.||||||||||||:.|||.||||||||||||.    .|.|   |||.||:...|||
Human   642 ETAAYKIMRTLDVDYVLVIFGGVIGYSGDDINKFLWMVRIA----EGEHPKDIRESDYFTPQGEF 702

  Fly   636 RVDKEGSPTLLNCLMYKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLV 700
            ||||.|||||||||||||.|||||:|..:.....|:||.|.|||||||.:...:|||:|:|||||
Human   703 RVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLV 767

  Fly   701 RIYKVKDLPNR 711
            ||||||...||
Human   768 RIYKVKAPDNR 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 427/715 (60%)
STT3 21..495 CDD:280649 277/492 (56%)
STT3BNP_849193.1 STT3 71..563 CDD:280649 277/492 (56%)
DXD motif 1. {ECO:0000250|UniProtKB:Q5HTX9} 101..103 2/2 (100%)
DXD motif 2. {ECO:0000250|UniProtKB:P39007} 221..223 2/2 (100%)
SVSE motif. {ECO:0000250|UniProtKB:Q5HTX9} 402..405 3/3 (100%)
WWDYG motif. {ECO:0000250|UniProtKB:P39007} 604..608 4/4 (100%)
Target acceptor peptide binding. {ECO:0000250|UniProtKB:B9KDD4} 604..606 2/2 (100%)
DK motif. {ECO:0000250|UniProtKB:P39007} 671..678 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D111618at33208
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126840
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1409
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.