DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and stt-3

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_498362.1 Gene:stt-3 / 175886 WormBaseID:WBGene00020437 Length:757 Species:Caenorhabditis elegans

Alignment Length:713 Identity:406/714 (57%)
Similarity:522/714 (73%) Gaps:32/714 (4%)


  Fly    21 LVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDRAWYPLG 85
            |:.:.:|.||..:.||:|||:::||||:||||||:||||.|..:.:.|||||.||||:|||||||
 Worm    19 LLTIVVLALAWFVGFASRLFAIVRFESIIHEFDPWFNYRATHHMVQHGFYKFLNWFDERAWYPLG 83

  Fly    86 RIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALTKEIHSTGAGLV 150
            ||:|||:|||||:||..::.::..||..:.||.|||||||.||.||.:.||.||||:.|.||||.
 Worm    84 RIVGGTVYPGLMVTSGLIHWILDSLNFHVHIREVCVFLAPTFSGLTAIATYLLTKELWSPGAGLF 148

  Fly   151 AAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAMSALAYFYMVSSWGG 215
            ||..|:|.|||.||||||||||||||||.:.||||||:|::|||:|.|:::.||:||||||:|||
 Worm   149 AACFIAISPGYTSRSVAGSYDNEGIAIFALQFTYYLWVKSLKTGSIMWASLCALSYFYMVSAWGG 213

  Fly   216 YVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPIQSSEHMLALGTFGL 280
            |||:|||||||.|||:|.||:|.|::::|::.||:.||||||:.||||||:::||||.|.|.|||
 Worm   214 YVFIINLIPLHALALIIMGRYSSRLFVSYTSFYCLATILSMQVPFVGFQPVRTSEHMPAFGVFGL 278

  Fly   281 CQIHAFVDYLRSRIPKDHFDLLF---KTLVSSVLTVVFVVGTLLTLTGKVSPWTGRFYSLLDPSY 342
            .||.|.:.|.|:||.:..|..||   .|::.::..||:..   |...|.|:|::||||||.|..|
 Worm   279 LQIVALMHYARNRITRQQFMTLFVGGLTILGALSVVVYFA---LVWGGYVAPFSGRFYSLWDTGY 340

  Fly   343 AKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILYGVTSIYFAGVM 407
            ||.||||||||||||||:|.||:|||.|...:||.||::|..|:.|..:|||||.|:::||||||
 Worm   341 AKIHIPIIASVSEHQPTTWVSFFFDLHITAAVFPVGLWYCIKKVNDERVFIILYAVSAVYFAGVM 405

  Fly   408 VRLMLVLAPVMCVLSGIAISHLLAKYIKSVDA--GSSSKQG--------------VESKRQHKKL 456
            |||||.|.|.:|||:||..|:...||:|..:.  .|||:.|              |:|:..:   
 Worm   406 VRLMLTLTPAVCVLAGIGFSYTFEKYLKDEETKERSSSQSGTTKDEKLYDKAAKNVKSRNAN--- 467

  Fly   457 EQQTGGVKSEVAIGFVGVITLMLIVYTLHCTWVTSEAYSSPSIVLSARSHDGGRIIFDDFREAYY 521
            :....||.|.|......::.:.|:::.:|.|:|||.|||.||:||.:.:::|.|||.|||||||:
 Worm   468 DGDESGVSSNVRTIISIILVIFLLMFVVHATYVTSNAYSHPSVVLQSSTNNGDRIIMDDFREAYH 532

  Fly   522 WLQMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDV 586
            ||:.||.:|||:||||||||||..|||||.|||||||||:||:.||:||:|:|..|||||.||||
 Worm   533 WLRENTADDARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMTELDV 597

  Fly   587 DYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGAH---IREKDYYAANGEFRVDKEGSPTLLNC 648
            ||:||||||:.|||.||||||||||||.    :|.|   |||::|:.:.||:......|.|:|||
 Worm   598 DYILVIFGGVIGYSGDDINKFLWMVRIA----QGEHPKDIREENYFTSTGEYSTGAGASETMLNC 658

  Fly   649 LMYKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVKDLPNR 711
            |||||.|||||:......:|.|:||.|...||.||..|:.:|||||||:|||||||.|.||||
 Worm   659 LMYKMSYYRFGETRVGYNQAGGFDRTRGYVIGKKDITLEYIEEAYTTENWLVRIYKRKKLPNR 721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 406/714 (57%)
STT3 21..495 CDD:280649 267/493 (54%)
stt-3NP_498362.1 STT3 19..506 CDD:280649 267/493 (54%)
Stt3 22..751 CDD:224206 405/711 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D111618at33208
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126840
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1409
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.