DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and Stt3a

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_032434.3 Gene:Stt3a / 16430 MGIID:105124 Length:705 Species:Mus musculus

Alignment Length:701 Identity:540/702 (77%)
Similarity:616/702 (88%) Gaps:7/702 (1%)


  Fly    13 LTWDKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFD 77
            |:::||:.|:||.||.:||||||:||||:|||||||||||||||||||||||||:||||||||||
Mouse     9 LSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFD 73

  Fly    78 DRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALTKEI 142
            ||||||||||||||||||||:||||:|.::...::|||||||||||||.|||.||:|||.||||:
Mouse    74 DRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKEL 138

  Fly   143 HSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAMSALAYF 207
            ...||||:|||:|::||||||||||||||||||||||||.|||:||||||||:|:|:|..|||||
Mouse   139 KDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAAKCALAYF 203

  Fly   208 YMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPIQSSEHM 272
            |||||||||||||||||||||.||:|||||||||:||.|:||:|||||||||||||||:.|||||
Mouse   204 YMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHM 268

  Fly   273 LALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWTGRFYSL 337
            .|.|.|||||||||||||||::....|::||::::|.|..|:..||.||.||||:||||||||||
Mouse   269 AAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKISPWTGRFYSL 333

  Fly   338 LDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILYGVTSIY 402
            ||||||||:|||||||||||||:|||:|||||:|||:||.|||:|||.|:|:.||||:|||||:|
Mouse   334 LDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMY 398

  Fly   403 FAGVMVRLMLVLAPVMCVLSGIAISHLLAKYIKSVDAGSSSKQGVESKRQHKKLEQQTGGVKSEV 467
            |:.||||||||||||||:||||.:|.:|:.|:|::|.....|:.       ||.:..|..:|:||
Mouse   399 FSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMKNLDISRPDKKS-------KKQQDSTYPIKNEV 456

  Fly   468 AIGFVGVITLMLIVYTLHCTWVTSEAYSSPSIVLSARSHDGGRIIFDDFREAYYWLQMNTPEDAR 532
            |.|.:.|:...||.||.|.||||||||||||||||||..||.||||||||||||||:.||||||:
Mouse   457 ASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAK 521

  Fly   533 IMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLT 597
            :|||||||||||||||||||||||||||||||||||||||:|||||||||||||.||||||||||
Mouse   522 VMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLT 586

  Fly   598 GYSSDDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQMY 662
            ||||||||||||||||||||:.|.||:|.|||...||||||:||||.||||||||||||||||:|
Mouse   587 GYSSDDINKFLWMVRIGGSTETGRHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVY 651

  Fly   663 TEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVKDLPNRGV 713
            ||..:..|:||||.||||||||||||:|||||||||||||||||||.|||:
Mouse   652 TEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGL 702

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 536/693 (77%)
STT3 21..495 CDD:280649 348/474 (73%)
Stt3aNP_032434.3 STT3 17..484 CDD:280649 348/474 (73%)
DXD motif 1. {ECO:0000250|UniProtKB:Q5HTX9} 47..49 2/2 (100%)
DXD motif 2. {ECO:0000250|UniProtKB:P39007} 167..169 2/2 (100%)
SVSE motif. {ECO:0000250|UniProtKB:Q5HTX9} 348..351 3/3 (100%)
WWDYG motif. {ECO:0000250|UniProtKB:P39007} 525..529 4/4 (100%)
Target acceptor peptide binding. {ECO:0000250|UniProtKB:B9KDD4} 525..527 2/2 (100%)
DK motif. {ECO:0000250|UniProtKB:P39007} 592..599 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153564552
eggNOG 1 0.900 E1_COG1287
Hieranoid 1 1.000
Homologene 1 1.000 H40617
Inparanoid 1 1.050 1133 1.000 Inparanoid score I216
Isobase 1 0.950 0 Normalized mean entropy S482
OMA 1 1.010
OrthoDB 1 1.010 D111618at33208
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 1 1.000 T1084811
orthoMCL 1 0.900 OOG5_126840
Panther 1 1.100 LDO PTHR13872
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1409
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.