DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and stt3b

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_002941861.2 Gene:stt3b / 100495934 XenbaseID:XB-GENE-969894 Length:822 Species:Xenopus tropicalis

Alignment Length:729 Identity:431/730 (59%)
Similarity:541/730 (74%) Gaps:31/730 (4%)


  Fly     6 GGVARGLLTWDKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFY 70
            ||::.||......:.|:...||.||.:..|::|||:|:||||:||||||:||||:|..||..|||
 Frog    54 GGLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFY 118

  Fly    71 KFHNWFDDRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVT 135
            :|.||||:|||||||||:|||:|||||:|:..::.::.:||:|:.||:|||||||.||.||::.|
 Frog   119 EFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHWILNMLNITVHIRDVCVFLAPVFSGLTSIST 183

  Fly   136 YALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSA 200
            :.||:|:.:.||||:||..|:|||||||||||||:||||||||.:.||||||:|:||||::||:.
 Frog   184 FLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTI 248

  Fly   201 MSALAYFYMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQP 265
            ...|:||||||:||||||:||||||||..|::..|:|.|:||||||.|.||.||||||.||||||
 Frog   249 CCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQP 313

  Fly   266 IQSSEHMLALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPW 330
            |::||||.|.|:..|.|.:||:.|||.::.|..|..||...||....|||:....||.||.::||
 Frog   314 IRTSEHMAAAGSHALLQAYAFLQYLRDKLSKQDFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPW 378

  Fly   331 TGRFYSLLDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIIL 395
            :||||||.|..|||.||||||||||||||:|.||:|||.|||..|||||:||...:.|..:|:.|
 Frog   379 SGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVAL 443

  Fly   396 YGVTSIYFAGVMVRLMLVLAPVMCVLSGIAISHLLAKYI------------KSVDAGSSS----- 443
            |.::::|||||||||||.|.||:|:||.||.|::...|:            .|.|...:|     
 Frog   444 YAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEERNSGTLYD 508

  Fly   444 KQGVESKR--QHKKLEQQTG-GVKSEVAIGFVGVITLMLIVYTLHCTWVTSEAYSSPSIVLSARS 505
            |.|...|.  :.:|.|:..| .:||.|.:    ::.::|:::.:|||||||.||||||:||::.:
 Frog   509 KAGKVRKHVSEQEKAEEGLGPNIKSIVTM----LMLMLLMMFAVHCTWVTSNAYSSPSVVLASYN 569

  Fly   506 HDGGRIIFDDFREAYYWLQMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAM 570
            |||.|.|.||||||||||:.||.|.||:||||||||||..|||||.|||||||||:||:.||:||
 Frog   570 HDGTRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAM 634

  Fly   571 ASSEEKAYEIMRELDVDYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGAH---IREKDYYAAN 632
            :|:|..|||||:.|||||||:||||:.|||.||||||||||||.    .|.|   |||.||:...
 Frog   635 SSNETAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIA----EGEHPKDIRESDYFTPQ 695

  Fly   633 GEFRVDKEGSPTLLNCLMYKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEH 697
            |||||||.|||||||||||||.|||||:|..:.....|:||.|.|||||||.:...:|||:|:||
 Frog   696 GEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEH 760

  Fly   698 WLVRIYKVKDLPNR 711
            |||||||||.|.||
 Frog   761 WLVRIYKVKQLENR 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 427/717 (60%)
STT3 21..495 CDD:280649 276/494 (56%)
stt3bXP_002941861.2 Stt3 68..769 CDD:224206 423/709 (60%)
STT3 69..559 CDD:280649 276/494 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D111618at33208
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.