DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and RUNX2

DIOPT Version :8

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001019801.3 Gene:RUNX2 / 860 HGNCID:10472 Length:521 Species:Homo sapiens

Alignment Length:687 Identity:200/688 (29%)
Similarity:277/688 (40%) Gaps:233/688 (34%)


  Fly     5 AEVSSTTSNQIQQQQQQHQQQQQHQLLQHQQQQTATTTTTKRRNAESSASSNNNNNNNTSTTNNN 69
            ::||...:.|.||||||.|||||.|..|.|||:.|.........|.::|:               
Human    40 SDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAA--------------- 89

  Fly    70 NTNNNNNSTTNNNNNNNNNNVKTKPVDTSPYLTPENLIERTVDVLLAEHPGELVKTGSPHVVCTT 134
                                        .|.|.|.: ..||:..::|:||.|||:|.||:.:|:.
Human    90 ----------------------------VPRLRPPH-DNRTMVEIIADHPAELVRTDSPNFLCSV 125

  Fly   135 LPTHWRSNKTLPIAFKVLALGEVMDGTIVTIRAGNDENFCGELRNCTAVMKNQVAKFNDLRFVGR 199
            ||:|||.|||||:||||:|||||.|||:||:.||||||:..||||.:||||||||:|||||||||
Human   126 LPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGR 190

  Fly   200 SGRGKSFTLTIVISTNPIQIATYTKAIKVTVDGPREPRSKVRHQ----GFHPFAFGPQRFG---- 256
            |||||||||||.:.|||.|:|||.:|||||||||||||   ||:    ...|..|..:...    
Human   191 SGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPR---RHRQKLDDSKPSLFSDRLSDLGRI 252

  Fly   257 PDPLM-AGLPFKLPGFAHHLVGMHSHLHAPDWRAHMALGGRPAAFTA-APFFGHHAAAFPTASGL 319
            |.|.| .|:|.:.|                          ||:..:| :||              
Human   253 PHPSMRVGVPPQNP--------------------------RPSLNSAPSPF-------------- 277

  Fly   320 RGLSGDSQQHQQQQQQHQLATVGAAHSTTSPEGSPTTTTTSGTQLSAFVQPPMTSSPPPVTSLQH 384
             ...|.||....:|.|            :||..|...:..|  .||....|.:.|:.|       
Human   278 -NPQGQSQITDPRQAQ------------SSPPWSYDQSYPS--YLSQMTSPSIHSTTP------- 320

  Fly   385 DNNNNNSNNNNSSSHIDAGFESDSISVTGSPRKSLGSPLTHDEEEAEAE-----AEAEAEAEAEA 444
                       .||....|..    ::|..||:      ..|::.|.::     :....:::|.|
Human   321 -----------LSSTRGTGLP----AITDVPRR------ISDDDTATSDFCLWPSTLSKKSQAGA 364

  Fly   445 EEAEVGGLSRNGGGIQGPLHSESSPGSGGAFTALIQRSGKNPTELFGGFAAAGGNHFAPSGHSFN 509
            .|.             ||.   |.|....:.::|.:....||.           .|: |:..::.
Human   365 SEL-------------GPF---SDPRQFPSISSLTESRFSNPR-----------MHY-PATFTYT 401

  Fly   510 PALAAQLFL-----------QSPLLPQSSQWLYTQLYGSY--SDLPWLRNAAAAAAANINPGQEN 561
            |.:.:.:.|           ..|..|.|||    ...|.:  |..|:|....::.:...      
Human   402 PPVTSGMSLGMSATTHYHTYLPPPYPGSSQ----SQSGPFQTSSTPYLYYGTSSGSYQF------ 456

  Fly   562 SGIPPLGSNPDHDGVNLIKRCVTLITHNPPDAENANPNASPPVSSTRRSPSPVETIDLDDVSTTS 626
                |:....|.....::..|.|  |.|  .:...|||.          |:..:.:|.|...::|
Human   457 ----PMVPGGDRSPSRMLPPCTT--TSN--GSTLLNPNL----------PNQNDGVDADGSHSSS 503

  Fly   627 RSASGSSGHGGGVGGGGAVGPIRTRTPKPSADVWRPY 663
            .:...|||                   :....|||||
Human   504 PTVLNSSG-------------------RMDESVWRPY 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 91/121 (75%)
RUNX2NP_001019801.3 polyglutamine repeat 49..71 16/22 (73%)
polyalanine repeat 73..89 3/16 (19%)
Runt 109..230 CDD:307137 92/124 (74%)
Required for interaction with FOXO1. {ECO:0000250} 242..258 4/16 (25%)
Herpes_BLLF1 <266..481 CDD:330317 57/344 (17%)
Interaction with KAT6A. {ECO:0000250} 336..439 24/141 (17%)
Interaction with KAT6B. {ECO:0000269|PubMed:11965546} 374..468 18/120 (15%)
RunxI 430..521 CDD:312115 26/138 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 1 1.000 T130118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3284
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.