DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and runx1

DIOPT Version :8

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_571678.1 Gene:runx1 / 58126 ZFINID:ZDB-GENE-000605-1 Length:451 Species:Danio rerio

Alignment Length:486 Identity:161/486 - (33%)
Similarity:206/486 - (42%) Gaps:146/486 - (30%)


  Fly   106 LIERTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALGEVMDGTIVTIRAGND 170
            :.:|::..:|::||||||:|.||:.:|:.||||||.||||||||||:|||::.|||:||:.||||
Zfish    51 MADRSMVEVLSDHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDIPDGTLVTVMAGND 115

  Fly   171 ENFCGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIATYTKAIKVTVDGPRE 235
            ||:..||||.||.:|||||:||||||||||||||||||||.:.|||.|:|||.:|||:|||||||
Zfish   116 ENYSAELRNATAAIKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPRE 180

  Fly   236 PRSKVRHQGFHPFAFGPQRFGPDPLMAGLPFKLPG---FAHHLVGMHSHLHAPDWRAHMALGGRP 297
            ||   ||           |..||..:.      ||   |:..|                    |.
Zfish   181 PR---RH-----------RQKPDEAVK------PGALAFSEQL--------------------RR 205

  Fly   298 AAFTAAPFFGHHAAAFPTASGLRGLSGDSQQHQQQQQQHQLAT-----------------VGAAH 345
            :|...:|   ||..|..|...|......|..|.|.....|:.|                 ..|.|
Zfish   206 SAMRCSP---HHGPAPNTRPTLNTPPFGSPAHSQIPDSRQMQTSPSWSYEQSYPYLGPISTPAVH 267

  Fly   346 STTSPEGSPTTTTTSGTQLSAFVQP-----------------------------PMTSSPPPVTS 381
            .||..  ||..|.....:|:||..|                             ..|.:|.||||
Zfish   268 PTTPI--SPNRTALHCPELTAFTDPRVGLERSFPSLPSLPDGRFSDPRVPYPTGAFTYTPTPVTS 330

  Fly   382 LQHDNNNNNSNNNNSSSHIDAGFESDSISVTGSPRKSLGSPLTHDEEEAEAEAEAEAEAEAEAEE 446
            .                 |..|     :|...||.....:.|      ..|.....::|:|.|.:
Zfish   331 A-----------------IGIG-----MSAMSSPAGRYHTYL------PPAYPAGSSQAQAGAFQ 367

  Fly   447 AEVGGLSRNGGGIQGPLHSESSPGSGGAFTALIQRSGKNPTELFGGFAAAGGNHFAPSGHSFNPA 511
            |.           ..|.|...|..:|....:::...|           ||.|....|.......|
Zfish   368 AS-----------SSPYHLYYSSAAGSYQFSMMPSGG-----------AAAGERSPPRILPCTNA 410

  Fly   512 LAAQLFLQSPLLPQSSQWLYTQLYGSYSDLP 542
            ......|. |.||..|:.: .:..||:|..|
Zfish   411 STGSALLH-PSLPNQSEGV-VEAEGSHSSSP 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 90/120 (75%)
runx1NP_571678.1 Runt 63..184 CDD:307137 90/123 (73%)
Atrophin-1 <160..426 CDD:331285 82/361 (23%)
RunxI 359..451 CDD:312115 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.