DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and runx2b

DIOPT Version :8

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_998027.2 Gene:runx2b / 405788 ZFINID:ZDB-GENE-040629-4 Length:464 Species:Danio rerio

Alignment Length:613 Identity:182/614 (30%)
Similarity:253/614 (41%) Gaps:206/614 (34%)


  Fly    77 STTNNNNNNNNNNVKTKPVDTSPYLTPENLIERTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRS 141
            |...|:.|:|....:.:.....|.|..:.  .|::..::|:||.|||:|.||:.:|:.||:|||.
Zfish    32 SVKMNDVNSNAGPQQQQDGAVVPRLRAQE--NRSMAEIIADHPAELVRTDSPNFLCSVLPSHWRC 94

  Fly   142 NKTLPIAFKVLALGEVMDGTIVTIRAGNDENFCGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSF 206
            |||||:||||:|||||.|||:||:.||||||:..||||.:.|||||||:||||||||||||||||
Zfish    95 NKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASGVMKNQVARFNDLRFVGRSGRGKSF 159

  Fly   207 TLTIVISTNPIQIATYTKAIKVTVDGPREPRSKVRHQGFHPFAFGPQRFGPDPLMAGLPFKLPGF 271
            ||||.:.|||.|:|||.:|||||||||||||   ||:        |:                  
Zfish   160 TLTITVFTNPPQVATYHRAIKVTVDGPREPR---RHR--------PK------------------ 195

  Fly   272 AHHLVGMHSHLHAPDWRAHMALGGRPAAFTAAPFFGHHAAAFPTASGLRGLSGDSQQHQQQQQQH 336
                                 |...|.|                     ||..|.....::.:| 
Zfish   196 ---------------------LDDSPKA---------------------GLFSDRLSELERIRQ- 217

  Fly   337 QLATVGAAHSTTSPE---GSPTTTTTSG-TQLSAFVQPPMTSSPPPVTSLQHDNNNNN------S 391
              .|:.....|.:|.   .||.:.|..| ||::   .|....|.||   ..:|....:      |
Zfish   218 --TTMRVTVPTQTPRPSLSSPNSYTPQGQTQIT---DPRQAQSSPP---WSYDQTYPSYLSPMAS 274

  Fly   392 NNNNSSSHIDAGFESDSISVTGSPRKSLGSPLTHDEEEAEAEAEAEAEAEAEAEEAEVGGLSRNG 456
            .:.:|::.:.:...:...|::..||:..||.   |......:.|.:..|.:...|:..       
Zfish   275 PSVHSTTPLSSSRATGLPSISDVPRRLPGST---DLSPFPGQFERQFPAFSSLTESRF------- 329

  Fly   457 GGIQGPLHSESSPGS--GGAFTALIQRSGKNPTELFGGFAAAGGNHFAPSGHSFNPALAAQLFLQ 519
                      |||..  ...||       ..||.:..|. :.|..|:    |::.|         
Zfish   330 ----------SSPRMHYPATFT-------YTPTPVTTGM-SLGSAHY----HTYLP--------- 363

  Fly   520 SPLLPQSSQWLYTQLYGSY--SDLPWLRNAAAAAAANIN--PGQENSG---IPPLGSNPDHDGVN 577
             |..|.|:|    ...|.:  |..|:|...|::.:...:  ||.|.|.   :||..|  ...|.:
Zfish   364 -PPYPGSTQ----SQSGPFQSSSTPYLYYGASSGSYQFSMVPGGERSPTRMMPPCTS--ASTGTS 421

  Fly   578 LIKRCVTLITHNPPDAENANPNASPPVSSTRRSPSPVETIDLDDVSTTSRSASGSSGHGGGVGGG 642
            |:                 |||.            ||:             |.||    |||.|.
Zfish   422 LV-----------------NPNL------------PVQ-------------ADGS----GGVEGD 440

  Fly   643 GAVGPIRTRTP-------KPSADVWRPY 663
            |:    .:.:|       :....|||||
Zfish   441 GS----HSNSPTLLNPAGRMDEGVWRPY 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 90/121 (74%)
runx2bNP_998027.2 Runt 71..192 CDD:279225 91/124 (73%)
RunxI 370..464 CDD:285676 33/150 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3284
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.