DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and Runx1

DIOPT Version :8

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001104491.1 Gene:Runx1 / 12394 MGIID:99852 Length:465 Species:Mus musculus

Alignment Length:461 Identity:163/462 (35%)
Similarity:221/462 (48%) Gaps:99/462 (21%)


  Fly   108 ERTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALGEVMDGTIVTIRAGNDEN 172
            :|::..:||:||||||:|.||:.:|:.||||||.||||||||||:|||:|.|||:||:.||||||
Mouse    62 DRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDEN 126

  Fly   173 FCGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIATYTKAIKVTVDGPREPR 237
            :..||||.||.||||||:||||||||||||||||||||.:.|||.|:|||.:|||:|||||||||
Mouse   127 YSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR 191

  Fly   238 SKVRHQGFHPFAFGPQRFGPDPLMAGLPFKLPGFAHHLVGMHSHLHAPDWRAHMALGGRPAAFTA 302
               ||:         |:.........|     .|:..|..:...              |..|...
Mouse   192 ---RHR---------QKLDDQTKPGSL-----SFSERLSELEQL--------------RRTAMRV 225

  Fly   303 APFFGHHAAAFPTASGLRGLSGDSQQHQQQQQQHQLATVGAAHSTTSPEGSPTTTTTS----GTQ 363
            :|   ||.|  ||.:....|:..:..:.|.|.|.|    .|.....||   |.:...|    |:.
Mouse   226 SP---HHPA--PTPNPRASLNHSTAFNPQPQSQMQ----DARQIQPSP---PWSYDQSYQYLGSI 278

  Fly   364 LSAFVQPPMTSSP---PPVTSLQHDNNNNNSNNNNSSSHIDAGFESDSISVTGSPRK-----SLG 420
            .|:.|.|....||   ..:|||..:.::..|.             :..::..|.||:     |:.
Mouse   279 TSSSVHPATPISPGRASGMTSLSAELSSRLST-------------APDLTAFGDPRQFPTLPSIS 330

  Fly   421 SPLTHDEEEAEAEAEAEAEAEAEAEEAEVG-GLSRNGGGIQ-----GPLHSESSPGSGGAFTALI 479
            .|..|         ...|...:....:.:| |:|......:     .|.:..||....|.|    
Mouse   331 DPRMH---------YPGAFTYSPPVTSGIGIGMSAMSSASRYHTYLPPPYPGSSQAQAGPF---- 382

  Fly   480 QRSGKNPTELFGGFAAAGGNHFAPSGHSFNPA--------LAAQLFLQSPLLPQSSQWLYTQLYG 536
             ::|.....|:.| |:||...|:..|...:|.        .:....|.:|.||..|..:.|:  |
Mouse   383 -QTGSPSYHLYYG-ASAGSYQFSMVGGERSPPRILPPCTNASTGAALLNPSLPSQSDVVETE--G 443

  Fly   537 SYSDLP 542
            |:|:.|
Mouse   444 SHSNSP 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 92/121 (76%)
Runx1NP_001104491.1 Runt 72..193 CDD:307137 93/124 (75%)
RunxI 375..465 CDD:312115 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 1 1.000 T130894
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3284
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.