DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and runx3

DIOPT Version :8

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:XP_002936643.1 Gene:runx3 / 100485729 XenbaseID:XB-GENE-487784 Length:396 Species:Xenopus tropicalis

Alignment Length:362 Identity:145/363 (40%)
Similarity:178/363 (49%) Gaps:107/363 (29%)


  Fly   109 RTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALGEVMDGTIVTIRAGNDENF 173
            |||..:||:|.||||:|.||:.:|:.||:|||.|||||:||||:|||:|.|||:||:.||||||:
 Frog    45 RTVVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENY 109

  Fly   174 CGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIATYTKAIKVTVDGPREPRS 238
            ..||||.:||||||||:||||||||||||||||||||.:.|:|.|:|||.:||||||||||||| 
 Frog   110 SAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTSPTQVATYHRAIKVTVDGPREPR- 173

  Fly   239 KVRH-------------------QGF---------------HPFAF-------GPQRFGP--DPL 260
              ||                   |.|               :||:.       ||....|  ||.
 Frog   174 --RHRQKLEEQSKPFSDRFSDLRQTFRVQPNSNPRATLTNTNPFSSQAQTQIQGPTDLNPFTDPR 236

  Fly   261 MAGLPFK-LPGFAHHLVGMHSHLHAPDWRAHMALGGRPAAFTAAPFFGHHAAAFPTASGLRGLSG 324
            ....||. ||...      .|....|  |.|.     |:|.::|  |.:.|:  |:.:|:.|:  
 Frog   237 QFERPFSALPSLT------ESRFSDP--RMHY-----PSAMSSA--FSYTAS--PSTTGIGGI-- 282

  Fly   325 DSQQHQQQQQQHQLATVGAAHSTTSPEGSPTTTTTSGTQLSAFVQPPMTSSPPPVTSLQHDNNNN 389
                                    |..|.||||....|.|           |||... ...|.:.
 Frog   283 ------------------------SMTGMPTTTRFHHTYL-----------PPPYPG-SSQNQSG 311

  Fly   390 NSNNNNSSSHIDAGFESDSIS---VTG--SPRKSLGS 421
            ....|.|..|:..|..|.|..   |.|  ||.:.|.|
 Frog   312 PFQTNASPYHLYYGTSSGSYQFSMVAGERSPSRMLSS 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 89/121 (74%)
runx3XP_002936643.1 Runt 54..175 CDD:279225 90/124 (73%)
RunxI 306..396 CDD:285676 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.