DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and runx1

DIOPT Version :8

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:XP_012813452.1 Gene:runx1 / 100485449 XenbaseID:XB-GENE-483164 Length:500 Species:Xenopus tropicalis

Alignment Length:599 Identity:186/600 (31%)
Similarity:251/600 (42%) Gaps:182/600 (30%)


  Fly   102 TPENLIERTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALGEVMDGTIVTIR 166
            |..|::|     :|::||||||:|.||:.:|:.||||||.||||||||||:|||:|.|||:||:.
 Frog    47 TDRNMVE-----VLSDHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVM 106

  Fly   167 AGNDENFCGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIATYTKAIKVTVD 231
            ||||||:..||||.||.||||||:||||||||||||||||||||.:.|||.|:|||.:|||:|||
 Frog   107 AGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVD 171

  Fly   232 GPREPRSKVRHQGFHPFAFGPQRFGPDPLMAGLPFKLPGFAHHLVGMHSHLHAPDWRAHMALGGR 296
            ||||||                |...||::.      ||    |||  ..:.|..:..: :||..
 Frog   172 GPREPR----------------RPKYDPIIG------PG----LVG--GQIQAEIYSIY-SLGKS 207

  Fly   297 PAAFTAAPFFGHHAAA-FPTASGLRGLSGDSQQHQQQQQQHQLATVGAAHSTTSPEGSPTTTTTS 360
            ..:.....|.||.... ..|.||.  ||...:..:.:..:.....|...|.|.:|  :|..|...
 Frog   208 ADSSCVGSFTGHRQKLDEQTKSGT--LSFSERLSELEHLRRTAMRVSPHHPTPTP--NPRATLNH 268

  Fly   361 GTQLSAFVQPPMTSSPPPVTSLQHDNNNNNSNNNNSSSHIDAGFESDSISVTGSPRKS------- 418
            .|   ||       :|.|.:.:|                       |:..|..||..|       
 Frog   269 ST---AF-------NPQPQSQIQ-----------------------DTRQVQASPPWSYDQSYQY 300

  Fly   419 LGSPLTHDEEEAEAEAEAEAEAEAEAEEAEVGGLSRNGGGIQGPLHSESSPGSG----------- 472
            |||..|.....|...:...|.:.... .||:.  ||..|.  ..|.:.|.|..|           
 Frog   301 LGSIATQSVHPATPISPGRASSMTSL-SAELS--SRLSGA--SDLTAFSDPRVGIDRQFSTLPSI 360

  Fly   473 --------GAFTALIQRSGKNPTELFGGF-----AAAGGNHFAPSGHSFNP-----ALAAQLFLQ 519
                    ||||       ..||.:..|.     |......:    |::.|     :..||   .
 Frog   361 SDPRMHYPGAFT-------YTPTPVTSGIGIGMSAMTSATRY----HTYLPPPYPGSSQAQ---S 411

  Fly   520 SPLLPQSSQWLYTQLYGSYSDLPWLRNAAAAAAANINPGQENSGIPPLGSNPDHDGVNLIKRCVT 584
            ||.  |:|...|...||:        :|.:....::..|.:.|  ||          .::..|  
 Frog   412 SPF--QTSSPSYHLYYGT--------SAGSYHQFSMMSGGDRS--PP----------RILPPC-- 452

  Fly   585 LITHNPPDAENANPNASPPVSSTRRSPSPVETIDLDDVSTTSRSASGSSGHGGGVGGGGAVGPIR 649
              |:....:...|||.          |:..:.::.:...:.|.:..|:                 
 Frog   453 --TNASTGSTLLNPNL----------PNQNDVVEAEGSHSNSPTNMGT----------------- 488

  Fly   650 TRTPKPSADVWRPY 663
              ||:....|||||
 Frog   489 --TPRLEEAVWRPY 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 92/121 (76%)
runx1XP_012813452.1 Runt 58..178 CDD:279225 92/136 (68%)
RunxI 407..500 CDD:285676 28/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.