DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA1L and Hsp68

DIOPT Version :8

Sequence 1:NP_005518.3 Gene:HSPA1L / 3305 HGNCID:5234 Length:641 Species:Homo sapiens
Sequence 2:NP_524474.1 Gene:Hsp68 / 42852 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster

Alignment Length:641 Identity:462/641 - (72%)
Similarity:551/641 - (85%) Gaps:15/641 - (2%)


Human     8 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDA 72
            |||||||||||||||||:|||||||||||||||||||||||:||||||||||||||||:|:||||
  Fly     3 AIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVFDA 67

Human    73 KRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFL 137
            ||||||:|:|..:|.|:|.|||:|||:.||||:.|.:||.||.|.|||||||||||:||||||:|
  Fly    68 KRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYL 132

Human   138 GHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDL 202
            |..|.:|||||||||||||||||||||.|||:|||||||||||||:||||||..:|||:||||||
  Fly   133 GTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDL 197

Human   203 GGGTFDVSILTIDDG-IFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLR 266
            |||||||||||||:| :|||::|||||||||||||||||:||.||||||:|||:..|.||:||||
  Fly   198 GGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRALRRLR 262

Human   267 TACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKA 331
            ||.|||||||||||:|:||||:||||.|||:.::||||||||.||||.|||||||||:||||||:
  Fly   263 TAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAKMDKS 327

Human   332 KIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLL 396
            :|||||||||||||||||.|||::|.|:.||.|||||||||||||:|||||.||||.:::|:||:
  Fly   328 QIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGDKSSEIKDVLLV 392

Human   397 DVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRF 461
            ||||||||:||||||||.||:|||.||.||::.||||:||||.|.|||:|||||:|||||:||.|
  Fly   393 DVAPLSLGIETAGGVMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFEGERALTKDNNVLGTF 457

Human   462 DLTGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEK 526
            ||||:||||||||:|:||||:||||||||||.::.||....|||.|||||||:.:|:||:.:|||
  Fly   458 DLTGVPPAPRGVPKIDVTFDLDANGILNVTAKEQGTGNAKNITIKNDKGRLSQADIDRMLSEAEK 522

Human   527 YKAEDEVQREKIAAKNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEK 591
            |..|||..|::|||:|.||:|.|.:|....:.|  .:||.:||:.|:::|:|.:.||:.|..|||
  Fly   523 YAEEDERHRQRIAARNQLETYLFGVKEAAENGG--DRISAADKSSIVERCSEAMKWLDSNTTAEK 585

Human   592 DEFDHKRKELEQMCNPIITKLYQGGCTG---PACGT---GYVPGRPATGPTIEEVD 641
            :|:::|.|||||.|:||:||:::||..|   |..|.   ||      .|||:||||
  Fly   586 EEYEYKLKELEQFCSPIMTKMHKGGGDGQQAPNFGQQAGGY------KGPTVEEVD 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSPA1LNP_005518.3 Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 3..388 309/380 (81%)
HSP70 4..641 CDD:331774 460/639 (72%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 396..511 85/114 (75%)
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 460/639 (72%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 305/375 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.