DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA1L and Hsc70-4

DIOPT Version :8

Sequence 1:NP_005518.3 Gene:HSPA1L / 3305 HGNCID:5234 Length:641 Species:Homo sapiens
Sequence 2:NP_001262586.1 Gene:Hsc70-4 / 41840 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster

Alignment Length:650 Identity:517/650 (80%)
Similarity:576/650 (89%) Gaps:12/650 (2%)


Human     4 AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNT 68
            :|..|:||||||||||||||||||||||||||||||||||||||||||||||||||||||||..|
  Fly     2 SKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQT 66

Human    69 VFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETA 133
            :|||||||||||:|..||:|||.|||:|::..||||:.|:||.|.|.|:|||||||||||:||||
  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETA 131

Human   134 EAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVL 198
            ||:||..||||||||||||||||||||||||.||||||||||||||||||||||||...|||:||
  Fly   132 EAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVL 196

Human   199 IFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVR 263
            ||||||||||||||:|||||||||:|||||||||||||||||:|||:|||||||||::.||||:|
  Fly   197 IFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALR 261

Human   264 RLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKM 328
            |||||||||||||||||||::|||||:||.||||||||||||||.|||||.|::||||||||||:
  Fly   262 RLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKL 326

Human   329 DKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDL 393
            ||:.||||||||||||||||||||||.|||::||||||||||||||||||||||.||||::||||
  Fly   327 DKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDL 391

Human   394 LLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLL 458
            |||||.|||||:|||||||:.|||||:||||||||.|||||||||||||||||||||||||||||
  Fly   392 LLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLL 456

Human   459 GRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLD 523
            |:|:|:||||||||||||||||||||||||||||.::||.|.|||||||||||||||:|||||.:
  Fly   457 GKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNE 521

Human   524 AEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQL 588
            ||||:.|||.|:|.|||||.||||.||||:.:.::.||.|||:||:..|||||||.:.||:.|||
  Fly   522 AEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQL 586

Human   589 AEKDEFDHKRKELEQMCNPIITKLYQGGCTGP------------ACGTGYVPGRPATGPTIEEVD 641
            |:|:|::|::||||.:|||||||||||....|            |.|.....|....||||||||
  Fly   587 ADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEVD 651

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSPA1LNP_005518.3 Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 3..388 328/384 (85%)
HSP70 4..641 CDD:331774 516/649 (80%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 396..511 101/115 (88%)
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 503/610 (82%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 323/375 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.