DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA1L and Hsc70Cb

DIOPT Version :8

Sequence 1:NP_005518.3 Gene:HSPA1L / 3305 HGNCID:5234 Length:641 Species:Homo sapiens
Sequence 2:NP_001189103.1 Gene:Hsc70Cb / 39557 FlyBaseID:FBgn0026418 Length:836 Species:Drosophila melanogaster

Alignment Length:710 Identity:212/711 (30%)
Similarity:344/711 (48%) Gaps:116/711 (16%)


Human     9 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAK 73
            ||||.|.....|...:.|.:|.:|||...|.|||:|||...:|:||.|||||...|.:|||...|
  Fly     4 IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNTVGGFK 68

Human    74 RLIGRKFNDPVVQADMKLWPFQVINEG-GKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFL 137
            ||:|||||||.||.::...|.:|...| |...:.|:|.||::.|.||::::|:.||||||:.|.:
  Fly    69 RLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFTKLKETSAAAM 133

Human   138 GHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGE---RHVLI 199
            ...|.:.||..|.:|.:::|:|..||..||||||||::||.||.|:|||..|....|   |:|:.
  Fly   134 QTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYKNDLFEDKPRNVIF 198

Human   200 FDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRR 264
            .|.|..:...|......|..::.|:..| .:||.|.|..|..:|.:||:.::|.:...|.||..|
  Fly   199 VDFGHSSLQASACAFTKGKLKMLASTWD-QIGGRDIDLALGDYFAKEFQERYKINAKTNARANLR 262

Human   265 LRTACERAKRTLS-SSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKM 328
            |.|..|:.|:.:| :||:..|.|:...:.||..:|:.|::.|||||.:.:...:..::.|.::|:
  Fly   263 LLTEIEKLKKQMSANSTKLPLNIECFLDDIDVSSSMQRSQMEELCAPVLQRVEQTFKRLLAESKL 327

Human   329 DKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDL 393
            ....||.:.:||||:|||.|::|::..|| :..:.::|.||||:.|||:|.||:  ..:.:|::.
  Fly   328 QLDDIHSVEIVGGSSRIPSVKQLIEQVFN-KPASTTLNQDEAVSRGAALQCAIM--SPAVRVREF 389

Human   394 LLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTY---------SDNQPGVL-IQVYEGE 448
            .:.|:...:        |........|..| .:.:||..|         :.|:.|.. :.:..|:
  Fly   390 GVTDIQNYA--------VKVLWDSEGSAAP-GEIEIFPQYHASPFSRLLTINRKGPFNVSIVYGQ 445

Human   449 RAMTKDNNLLGRFDLTGIPPAPRGVPQ-IEVTFDIDANGIL------------------------ 488
            :....|.. :|.:.:..:.|..||..| :::...|:.|||:                        
  Fly   446 QVPYPDQT-IGVWKVKDVKPTERGEGQDVKLKVRINNNGIVLISSATLVEKKEAEEAAAAAEQAA 509

Human   489 -----------------------------NVTATDKSTG-----------------------KVN 501
                                         |.|:|..|.|                       |..
  Fly   510 SEEKPGDQTNNTGEPADGQQEAYCENEDDNNTSTASSPGGQGWAQRVKGWFGSGADKKKKASKAT 574

Human   502 KITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGLKGKISE 566
            ::.:.......|..::........|....|:.:.|:|.||||||.:.::|::.:.....:..:.|
  Fly   575 ELPLECTTHGFSPVDLSNYTQQESKMIGNDQKETERIDAKNALEEFVYDMRNKLQGGPFERYVVE 639

Human   567 SDKNKILDKCNELLSWL-EVNQLAEKDEFDHKRKELEQMCNPIITKL----YQGGCTGPA 621
            :::.||:.:.|:|.:|| |..:..|:|.:..:.:.|.|..:||  ||    |:   .|||
  Fly   640 AEREKIVSQLNDLENWLYEDGEDCERDIYTSRLQALHQKTDPI--KLRASDYE---QGPA 694

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSPA1LNP_005518.3 Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 3..388 153/384 (40%)
HSP70 4..641 CDD:331774 212/711 (30%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 396..511 26/202 (13%)
Hsc70CbNP_001189103.1 HSPA4_like_NDB 2..381 CDD:212670 153/381 (40%)
HSP70 3..682 CDD:278441 205/692 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120161628
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.