DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA1L and Hsc70-1

DIOPT Version :8

Sequence 1:NP_005518.3 Gene:HSPA1L / 3305 HGNCID:5234 Length:641 Species:Homo sapiens
Sequence 2:NP_524063.1 Gene:Hsc70-1 / 39542 FlyBaseID:FBgn0001216 Length:641 Species:Drosophila melanogaster

Alignment Length:636 Identity:499/637 (78%)
Similarity:569/637 (89%) Gaps:2/637 (0%)


Human     8 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDA 72
            |:||||||||||||||||||||||||||||||||||||||::||||||||||||||||.||:|||
  Fly     6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMNPNNTIFDA 70

Human    73 KRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFL 137
            ||||||:|:|..||:|||.|||:|..|.|||::.|.||||.|:|||||:|||||||::|||||:|
  Fly    71 KRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYL 135

Human   138 GHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDL 202
            |..||:||:||||||||||||||||||.||||||||||||||||||||||||.|..||:||||||
  Fly   136 GGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDL 200

Human   203 GGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRT 267
            ||||||||:|||:|||||||||||||||||||||||||:|||:||:||||||:.|||||:|||||
  Fly   201 GGGTFDVSVLTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFQRKHKKDLGQNKRALRRLRT 265

Human   268 ACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332
            |||||||||||||||::|||||:||:|||||:||||||||..||||||:|||.||||||||||.:
  Fly   266 ACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNGDLFRGTMEPVAKALRDAKMDKGQ 330

Human   333 IHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLD 397
            ||||||||||||||||||||||:|||::||||||||||||||||||||||.|||||.||||||||
  Fly   331 IHDIVLVGGSTRIPKVQRLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEAVQDLLLLD 395

Human   398 VAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFD 462
            |.|||||:||||||||.|||||:|||||||||||||:||||||||||:|||||||:|||.||:|:
  Fly   396 VTPLSLGIETAGGVMTTLIKRNTTIPTKQTQIFTTYADNQPGVLIQVFEGERAMTRDNNSLGKFE 460

Human   463 LTGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKY 527
            |:.||||||||||:||||||||||||||||.:|||||.|:|||||||||||||:|||||.|||.|
  Fly   461 LSAIPPAPRGVPQVEVTFDIDANGILNVTALEKSTGKENRITITNDKGRLSKEDIERMVNDAEAY 525

Human   528 KAEDEVQREKIAAKNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKD 592
            :..||.||::|.|||.||||.|.::|.:.||.|..:.|.:|:..|..:.:|.::||:.|||||:.
  Fly   526 RQADEQQRDRINAKNQLESYCFQLRSTLDDEHLSSRFSPADRETIQQRSSETIAWLDANQLAERQ 590

Human   593 EFDHKRKELEQMCNPIITKLYQG-GCTGPACGTGYVPGRP-ATGPTIEEVD 641
            ||:||::|||::|:||||:|||| |...|....|..||.. .:||||||||
  Fly   591 EFEHKQQELERICSPIITRLYQGAGMAPPPTAGGSNPGATGGSGPTIEEVD 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSPA1LNP_005518.3 Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 3..388 323/380 (85%)
HSP70 4..641 CDD:331774 498/635 (78%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 396..511 98/115 (85%)
Hsc70-1NP_524063.1 PTZ00009 1..641 CDD:240227 498/635 (78%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 319/375 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.