DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA1L and CG7182

DIOPT Version :8

Sequence 1:NP_005518.3 Gene:HSPA1L / 3305 HGNCID:5234 Length:641 Species:Homo sapiens
Sequence 2:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster

Alignment Length:533 Identity:144/534 (27%)
Similarity:240/534 (45%) Gaps:99/534 (19%)


Human    10 GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMNPQNTV--- 69
            ||.:|.:..|:. |...||.|:|||.||:|.:.:.:.:.....: .|..||.::|..|:..|   
  Fly     6 GIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAVAHS 70

Human    70 -------------------------FDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSY 109
                                     ||.:.|:.|.  :..|.:|.:....:|:.           
  Fly    71 FQLLQPKEELTEEKLSSALREIPCDFDKEELVFRM--EHTVPSDREDQDDRVVT----------- 122

Human   110 KGENKAFYPEEISSMVLTKLKETAEAFLGH---------PVTNAVITVPAYFNDSQRQATKDAGV 165
                     :::|:..:|.....||..|.|         |:  ||:::|:|:..|..:...||..
  Fly   123 ---------KDLSAYQVTVELLRAELELAHQYHTDGEQAPI--AVLSIPSYYPASAYKLLADAAQ 176

Human   166 IAGLNVLRIINEPTAAAIAYGL-DKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTH 229
            .||.:|.:||.|||||.:.|.: ::..:..||||....||...|::..::.:|:|...||.|...
  Fly   177 TAGFHVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFP 241

Human   230 LGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGID 294
            :||..|...||....|||:||:|.|..:::|:|.::|||....|..|::.....|.||||.:|:|
  Fly   242 IGGRQFTEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAANCKHILTTMPSTQLYIDSLMDGVD 306

Human   295 FYTSITRARFEELCADLFRGTLEPVEKALRDAKMDK---AKIHDIVLVGGSTRIPKVQRLLQDYF 356
            :...::|||||.|...:....::.:.:.:..|:.:.   :||.||||:|.:.:|||:|..:...|
  Fly   307 YNAQMSRARFESLIQPVINNLIQQLGECVEQAQKEHPGLSKIDDIVLLGATMQIPKLQAAVGARF 371

Human   357 NGRDLNKSINPDEAVAYGAAVQAAIL---MGDKSEKVQDLLLLD------------VAPLSLGLE 406
            ....|:.|.:.||.||.|.|.||..|   :..:..|.:|.::.:            .|.|.||  
  Fly   372 PDAKLHNSHSADEVVAIGCARQAVCLIDPLEQQLHKEEDCVVAEDDLFIWHGNDESNAKLVLG-- 434

Human   407 TAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPG-VLIQVYEGERAMTKDNNLLGRFDLTGIPPAP 470
                       |.|.:|.| .:|....|:...| .:.:.....:..|.::.:|.|...:.||  .
  Fly   435 -----------RGSVLPAK-IRISLPQSEEGKGDDVSKAAASFKLRTGESEILARLPDSTIP--E 485

Human   471 RGVPQIEVTFDID 483
            .|:.|:||..|:|
  Fly   486 DGLYQLEVEVDVD 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSPA1LNP_005518.3 Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 3..388 120/424 (28%)
HSP70 4..641 CDD:331774 144/534 (27%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 396..511 22/102 (22%)
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 118/412 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.