DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA1L and Hsc70-5

DIOPT Version :8

Sequence 1:NP_005518.3 Gene:HSPA1L / 3305 HGNCID:5234 Length:641 Species:Homo sapiens
Sequence 2:NP_001286414.1 Gene:Hsc70-5 / 36583 FlyBaseID:FBgn0001220 Length:686 Species:Drosophila melanogaster

Alignment Length:606 Identity:306/607 (50%)
Similarity:409/607 (67%) Gaps:21/607 (3%)


Human     5 KGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPQNT 68
            ||..||||||||.||:.|.:..:.::|.|.:|.|||||:|||| |.|||:|..||.|...|..||
  Fly    51 KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTNSANT 115

Human    69 VFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETA 133
            .:..||||||:|:||.|:.|:....::|:........:.|..|  |.:.|.:|.:.:|.|:||||
  Fly   116 FYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVSSTDG--KVYSPSQIGAFILMKMKETA 178

Human   134 EAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVL 198
            ||:|..||.|||:||||||||||||||||||.||||||||:||||||||:|||:||  ..::.:.
  Fly   179 EAYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK--TEDKIIA 241

Human   199 IFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVR 263
            ::||||||||:|||.|..|:||||:|.|||.||||||||.:|:..|.|||:....||.::..|::
  Fly   242 VYDLGGGTFDISILEIQKGVFEVKSTNGDTLLGGEDFDNHIVNFLVAEFKKDSGIDIRKDNIAMQ 306

Human   264 RLRTACERAKRTLSSSTQANLEIDSLYEGID------FYTSITRARFEELCADLFRGTLEPVEKA 322
            ||:.|.|:||..||||.|.::.:.  |..:|      ....:||::.|.|..||.:.|::|.:||
  Fly   307 RLKEAAEKAKCELSSSQQTDINLP--YLTMDAAGPQHMNLKLTRSKLESLVGDLIKRTIQPCQKA 369

Human   323 LRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKS 387
            |.||::.|::|.:::||||.||:||||..:|:.| ||..::|:|||||||.|||||..:|.||  
  Fly   370 LSDAEVSKSEIGEVLLVGGMTRMPKVQSTVQELF-GRQPSRSVNPDEAVAVGAAVQGGVLAGD-- 431

Human   388 EKVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMT 452
              |.|:|||||.|||||:||.|||.|.||.||:|||||::|:|:|.||.|..|.|:|::|||.|.
  Fly   432 --VTDVLLLDVTPLSLGIETLGGVFTRLISRNTTIPTKKSQVFSTASDGQTQVEIKVHQGEREMA 494

Human   453 KDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEI 517
            .||.|||.|.|.||||||||||||||.||||||||::|:|.||.|||..:|.| ...|.|||:||
  Fly   495 NDNKLLGSFTLVGIPPAPRGVPQIEVVFDIDANGIVHVSAKDKGTGKEQQIVI-QSSGGLSKDEI 558

Human   518 ERMVLDAEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSW 582
            |.|:..||:|...|:.:||.|...|..||...:.::.:  |..|.::...:..|:..:..:|.:.
  Fly   559 ENMIKKAEEYATADKQKRELIEIVNQGESIVHDTETKM--EEFKSQLPAEECEKLKKEIADLRTL 621

Human   583 LEVNQLAEKDEFDHKRKELEQ 603
            |...:.|:.:|.......|:|
  Fly   622 LANKETADLEEVRKATSSLQQ 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSPA1LNP_005518.3 Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 3..388 201/390 (52%)
HSP70 4..641 CDD:331774 306/607 (50%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 396..511 75/115 (65%)
Hsc70-5NP_001286414.1 dnaK 51..666 CDD:234715 306/607 (50%)
HSPA9-like_NBD 51..428 CDD:212683 198/384 (52%)
Syntaphilin <566..>642 CDD:291936 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.