DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT3 and Sgsm1

Sequence 1:NP_001162808.1 Gene:GstT3 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006535185.1 Gene:Sgsm1 MGIID:107320 Length:1148 Species:Mus musculus

Alignment Length:123 Identity:27/124 (22%)
Similarity:52/124 (42%) Gaps:31/124 (25%)


  Fly     6 LASLLGLSNDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNMPF 70
            ||.||.:.:||......|.|::||         :..:.|.....|......|:|..|  |.:..|
Mouse   985 LAPLLVILDDEALAFSCFTELMKR---------MNQNFPHGGAMDTHFANMRSLIQI--LDSELF 1038

  Fly    71 EDCVVALRNGEH---------LTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSA 119
            |   :..:||::         ...|||:|:        ::|:.:.:.|::...:::|:
Mouse  1039 E---LMHQNGDYTHFYFCYRWFLLDFKREL--------VYDDVFSVWETIWAAKHVSS 1085

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 16/85 (19%)
GstA 47..243 CDD:223698 16/83 (19%)
GST_C_Theta 135..259 CDD:198292
Sgsm1XP_006535185.1 RUN 44..188 CDD:280855
PH_RUTBC 254..425 CDD:275431
TBC <936..1105 CDD:214540 27/124 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.