DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT3 and GstT4

Sequence 1:NP_001162808.1 Gene:GstT3 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster

Alignment Length:224 Identity:82/225 (36%)
Similarity:141/225 (63%) Gaps:1/225 (0%)


  Fly    41 MSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGY 105
            ||.|:::|:|.::|.||||:|:...|.:|||...:::..|||||.:|:..:|||:::|.|.|:||
  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGY 65

  Fly   106 KLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRT 170
            :|:|:|||.|:|:.:..:|||.||:..:.:||:||:|.||..::.:....||:..||.|.|....
  Fly    66 QLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTR 130

  Fly   171 PSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIR 235
            |::..:.....|:|..|:..|:::|..:.|:.|.:::.||:.|.|||:|.:...|:......|:.
  Fly   131 PADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLA 195

  Fly   236 AWLKRVRQSCNPYY-DVAHEFVYKISGTG 263
            .|.:.||:...|:| :|..||..|:.|:|
  Fly   196 RWYETVREELGPHYKEVLGEFEAKLKGSG 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 33/76 (43%)
GstA 47..243 CDD:223698 71/196 (36%)
GST_C_Theta 135..259 CDD:198292 39/125 (31%)
GstT4NP_572886.2 GstA 5..203 CDD:223698 71/198 (36%)
GST_N_Theta 5..80 CDD:239348 33/75 (44%)
GST_C_Theta 95..220 CDD:198292 39/125 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91154471
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I1952
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43917
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.