powered by:
Protein Alignment GstT3 and tbc
DIOPT Version :9
| Sequence 1: | NP_001162808.1 |
Gene: | GstT3 / 33047 |
FlyBaseID: | FBgn0031117 |
Length: | 268 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001285494.1 |
Gene: | tbc / 318059 |
FlyBaseID: | FBgn0052506 |
Length: | 1155 |
Species: | Drosophila melanogaster |
| Alignment Length: | 161 |
Identity: | 28/161 - (17%) |
| Similarity: | 48/161 - (29%) |
Gaps: | 73/161 - (45%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 135 QSRVDEFLEWQHMSLRLTCAMYFRTV-------W-------------LEPLLTGRTPSEAKIETF 179
|.:..:.|:.|..|:.:.|:...|.: | |..|:.||...|.|.:..
Fly 523 QQQQQQLLQAQSTSIEMVCSTMRRQIISRAFYGWLAYCRHLSTVRTHLSGLVHGRITPEMKADEE 587
Fly 180 RMQMER----NLDVV---------------------EEVWLEGKDFLTGSSLTVADIFAACEIEQ 219
.:..|| |::.| :||| .:|.|. :|.....:
Fly 588 GLTKERWQLLNVNGVLENATEFYRLVYFGGVQPELRQEVW----PYLLGH-------YAFGSTTE 641
Fly 220 TRMADYDVRIKYPKIRAWLKRVRQSCNPYYD 250
.| |:..::|..||:
Fly 642 DR-----------------KKQDETCKHYYE 655
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5210 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.