DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT3 and GSTT2

Sequence 1:NP_001162808.1 Gene:GstT3 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens

Alignment Length:223 Identity:72/224 (32%)
Similarity:118/224 (53%) Gaps:17/224 (8%)


  Fly    45 IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAE 109
            :..:.||:||||||::|..:.:.:|.|...|.|..|:|.:::| .:||...::|.:.|..:.|.|
Human     3 LELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEF-LQINSLGKLPTLKDGDFILTE 66

  Fly   110 SVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLE---PLLTGRTP 171
            |.|||.|||.|.:.|:|.||.....::||.|:|.|....:|.|..:   .:|::   ||:..:.|
Human    67 SSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGI---PLWVQVLGPLIGVQVP 128

  Fly   172 SEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRA 236
            .| |:|..|..|::.|..:|:.:|..:.||.|..:|:||:.|..|:.|.....|::....|::.|
Human   129 KE-KVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAA 192

  Fly   237 WLKRVR-----QSCNPYYDVAHEFVYKI 259
            |..||.     :.|..    ||..:..|
Human   193 WRGRVEAFLGAELCQE----AHSIILSI 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 30/76 (39%)
GstA 47..243 CDD:223698 68/204 (33%)
GST_C_Theta 135..259 CDD:198292 37/132 (28%)
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 30/76 (39%)
GstA 14..210 CDD:223698 65/205 (32%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 37/133 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95553744
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4428
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 1 1.000 T130104
orthoMCL 1 0.900 OOG5_127168
Panther 1 1.100 O PTHR43917
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.