DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx16 and TLG2

Sequence 1:NP_523420.1 Gene:Syx16 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_014624.1 Gene:TLG2 SGDID:S000005378 Length:397 Species:Saccharomyces cerevisiae

Alignment Length:348 Identity:86/349 (25%)
Similarity:154/349 (44%) Gaps:78/349 (22%)


  Fly    20 NRNHYDDRRGSDAERLLKHSVREAEEGLELQDDYGTPPAWLDKFEEAQYTMSKIKPKLDELGSLH 84
            |.:|....|.:| ||..||         |...| ..||.::|..::....:.:::...::|..::
Yeast    44 NMSHDISARLTD-ERKNKH---------ENHSD-ALPPIFIDIAQDVDDYLLEVRRLSEQLAKVY 97

  Fly    85 ARHLLRPAFDDQRDDECDIEVLSQIVSKLITSTH---RHIQCVRSSIGVGSKM----EQCLTVNA 142
            .::.| |.|:|:..||..||.||..|.:::...:   :.::.:.:|..|..|.    |..:..|.
Yeast    98 RKNSL-PGFEDKSHDEALIEDLSFKVIQMLQKCYAVMKRLKTIYNSQFVDGKQLSREELIILDNL 161

  Fly   143 VHCALLQLQELTVKFRASQNAYLLQLNSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDS 207
            ......::|..:.|||..||.||..||.         ||                          
Yeast   162 QKIYAEKIQTESNKFRVLQNNYLKFLNK---------DD-------------------------- 191

  Fly   208 FDNFLQPPAEGKSGNGYLFEDDEQA-----------IDDHFQRPPASRMTQQQLLLFEEENTRVA 261
                |:|.....|....|..|||:.           |:|:     :.|..|:|..|.:.......
Yeast   192 ----LKPIRNKASAENTLLLDDEEEEAAREKREGLDIEDY-----SKRTLQRQQQLHDTSAEAYL 247

  Fly   262 QHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRK 326
            :.|::|:|::.:.:.:::.||:::..:|.:|||::||||||:|.|...:....::|:||..||::
Yeast   248 RERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKATHYQKR 312

  Fly   327 NRKMCVILVLA----AVTFFMLL 345
            .:|..|||:|.    |:.||::|
Yeast   313 TQKCKVILLLTLCVIALFFFVML 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 18/58 (31%)
TLG2NP_014624.1 COG5325 35..338 CDD:227635 86/349 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C67496297
eggNOG 1 0.900 E1_COG5325
Hieranoid 1 1.000
Homologene 1 1.000 H2791
Inparanoid 1 1.050 89 1.000 Inparanoid score I1538
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003802
OrthoInspector 1 1.000 T1136618
orthoMCL 1 0.900 OOG5_127496
Panther 1 1.100 LDO PTHR19957
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3589
TreeFam 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.