DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and SYP41

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001031950.1 Gene:SYP41 / 832756 AraportID:AT5G26980 Length:322 Species:Arabidopsis thaliana


Alignment Length:301 Identity:96/301 - (31%)
Similarity:151/301 - (50%) Gaps:56/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDDECDIEVLSQIVSKLITSTH 118
            |.||||:|..||....:.:.:.|:.|||..||:.|: |:|.|.::|:.:||.|:|.::.|:..:.
plant    74 GLPPAWVDVSEEISVNIQRARTKMAELGKAHAKALM-PSFGDGKEDQHNIESLTQEITFLLKKSE 137

  Fly   119 RHIQCVRSSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYLLQLNSREERSQKYFDDGG 183
            :.:|.:.:|   |...:..:..|........||.|:::.|..|:.||.:|     |.||  :|| 
plant   138 KQLQRLSAS---GPSEDSNVRKNVQRSLATDLQLLSMELRKKQSTYLKRL-----RQQK--EDG- 191

  Fly   184 GAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDDE--QAIDDHFQRPPASRMT 246
                .|:..|:                         |.|.|..|:|:  ..:::|          
plant   192 ----MDLEMNL-------------------------SRNRYRPEEDDFGDMLNEH---------- 217

  Fly   247 QQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVS 311
            |...:...||   |:..||:|:.::|:|:.||..|.|||..:|.:|||::||||||:|...|.|.
plant   218 QMSKIKKSEE---VSVEREKEIQQVVESVNDLAQIMKDLSALVIDQGTIVDRIDYNIENVATTVE 279

  Fly   312 EGLRQLHKAEMYQRKNRKMCVILVLAAVTFFMLLLLILTKL 352
            :||:||.|||..||....:....||..:.|.|||||||.::
plant   280 DGLKQLQKAERTQRHGGMVKCASVLVILCFIMLLLLILKEI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 28/57 (49%)
SYP41NP_001031950.1 COG5325 73..318 CDD:227635 95/297 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3147
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2791
Inparanoid 1 1.050 128 1.000 Inparanoid score I1901
OMA 1 1.010 - - QHG53593
OrthoDB 1 1.010 - - D1182451at2759
OrthoFinder 1 1.000 - - FOG0003413
OrthoInspector 1 1.000 - - otm3137
orthoMCL 1 0.900 - - OOG6_101604
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2307
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.