DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx16 and SYP41

Sequence 1:NP_523420.1 Gene:Syx16 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001031950.1 Gene:SYP41 AraportID:AT5G26980 Length:322 Species:Arabidopsis thaliana

Alignment Length:301 Identity:96/302 (32%)
Similarity:151/302 (50%) Gaps:56/302 (19%)


  Fly    54 GTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDDECDIEVLSQIVSKLITSTH 118
            |.||||:|..||....:.:.:.|:.|||..||:.|: |:|.|.::|:.:||.|:|.::.|:..:.
plant    74 GLPPAWVDVSEEISVNIQRARTKMAELGKAHAKALM-PSFGDGKEDQHNIESLTQEITFLLKKSE 137

  Fly   119 RHIQCVRSSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYLLQLNSREERSQKYFDDGG 183
            :.:|.:.:|   |...:..:..|........||.|:::.|..|:.||.:|     |.||  :|| 
plant   138 KQLQRLSAS---GPSEDSNVRKNVQRSLATDLQLLSMELRKKQSTYLKRL-----RQQK--EDG- 191

  Fly   184 GAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDDE--QAIDDHFQRPPASRMT 246
                .|:..|:                         |.|.|..|:|:  ..:::|          
plant   192 ----MDLEMNL-------------------------SRNRYRPEEDDFGDMLNEH---------- 217

  Fly   247 QQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVS 311
            |...:...||   |:..||:|:.::|:|:.||..|.|||..:|.:|||::||||||:|...|.|.
plant   218 QMSKIKKSEE---VSVEREKEIQQVVESVNDLAQIMKDLSALVIDQGTIVDRIDYNIENVATTVE 279

  Fly   312 EGLRQLHKAEMYQRKNRKMCVILVLAAVTFFMLLLLILTKL 352
            :||:||.|||..||....:....||..:.|.|||||||.::
plant   280 DGLKQLQKAERTQRHGGMVKCASVLVILCFIMLLLLILKEI 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 28/58 (48%)
SYP41NP_001031950.1 SynN 77..185 CDD:214699 34/117 (29%)
SNARE_syntaxin16 231..287 CDD:277198 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2791
Inparanoid 1 1.050 128 1.000 Inparanoid score I1849
OMA 1 1.010
OrthoDB 1 1.010 D1182451at2759
OrthoInspector 1 1.000 T124901
orthoMCL 1 0.900 OOG5_127496
Panther 1 1.100 O PTHR19957
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.