DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx16 and SYP43

Sequence 1:NP_523420.1 Gene:Syx16 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_850519.1 Gene:SYP43 AraportID:AT3G05710 Length:331 Species:Arabidopsis thaliana

Alignment Length:384 Identity:107/385 (28%)
Similarity:176/385 (46%) Gaps:87/385 (23%)


  Fly     1 MTSRNLTEVFVIMRNNASKNRNHYDDRRGSDAERLLKH-SVREAEEGL----------------- 47
            |.:||.|.:|...||:.   |:.......|.:..|.:| |:..|:.||                 
plant     1 MATRNRTLLFRKYRNSL---RSVRAPMGSSSSSTLTEHNSLTGAKSGLGPVIEMASTSLLNPNRS 62

  Fly    48 ----ELQD---------DYGTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDD 99
                ..:|         ..|.||.|:|..||....:.:.:.|:.|||..||:.|: |:|.|.::|
plant    63 YAPVSTEDPGNSSRGTITVGLPPDWVDVSEEISVYIQRARTKMAELGKAHAKALM-PSFGDGKED 126

  Fly   100 ECDIEVLSQIVSKLITSTHRHIQCVRSSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAY 164
            :..||.|:|.|:.|:..:.:.:|.:.::   |...:..:..|........||.|:::.|..|:.|
plant   127 QHQIETLTQEVTFLLKKSEKQLQRLSAA---GPSEDSNVRKNVQRSLATDLQNLSMELRKKQSTY 188

  Fly   165 LLQLNSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDD 229
            |.:|     |.||  :||     .|:..|:                         :|:.|..|||
plant   189 LKRL-----RLQK--EDG-----ADLEMNL-------------------------NGSRYKAEDD 216

  Fly   230 EQAIDDH-FQRPPASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQG 293
            :  .||. |.....|::.:.:.:..|         ||:|:.::|:|:.:|..|.|||..:|.:||
plant   217 D--FDDMVFSEHQMSKIKKSEEISIE---------REKEIQQVVESVSELAQIMKDLSALVIDQG 270

  Fly   294 TVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRKMCVILVLAAVTFFMLLLLILTKL 352
            |::||||||::...:.|.:||:||.|||..||:...:....||..:.|.||:||||.::
plant   271 TIVDRIDYNIQNVASTVDDGLKQLQKAERTQRQGGMVMCASVLVILCFIMLVLLILKEI 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 25/58 (43%)
SYP43NP_850519.1 SynN 85..193 CDD:214699 33/117 (28%)
SNARE_syntaxin16 240..296 CDD:277198 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2791
Inparanoid 1 1.050 128 1.000 Inparanoid score I1849
OMA 1 1.010
OrthoDB 1 1.010 D1182451at2759
OrthoInspector 1 1.000 T124901
orthoMCL 1 0.900 OOG5_127496
Panther 1 1.100 LDO PTHR19957
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.