DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx16 and Syx8

Sequence 1:NP_523420.1 Gene:Syx16 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_524113.1 Gene:Syx8 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster

Alignment Length:195 Identity:41/196 (21%)
Similarity:77/196 (39%) Gaps:38/196 (19%)


  Fly   162 NAYLLQLNSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKS------ 220
            ||...:.:..||..|:..|       .|..|: :|.| ..|.|.:|..:.: |.|.|.:      
  Fly    67 NAITWETSPEEELQQRRID-------WDRLTS-QLRE-IREKFANSSRSNV-PAASGSAWQDQDL 121

  Fly   221 GNGYLFEDDEQAIDDHFQRPPASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDL 285
            |.|:.......|:|....:...:.|..||....|..:..:::.|:               :...|
  Fly   122 GPGHSNSSRNTALDVEALKQKKTEMLAQQNEGLEVLSATLSRQRQ---------------LATQL 171

  Fly   286 GHMVQEQGTVLDRIDYNVEQTQTRVSEGL-RQLHKAEMYQRKNRKMCVILVLAAVTFFMLLLLIL 349
            |:.|::|..:||    |:.....||..|: |:........|::......||:.|:  |:.:::::
  Fly   172 GNEVEDQNNILD----NLANAMDRVETGVQRETQSIGQVNRRDSTWGYWLVIIAL--FVAIIVVV 230

  Fly   350  349
              Fly   231  230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 12/59 (20%)
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19957
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.