DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx16 and Stx16

Sequence 1:NP_523420.1 Gene:Syx16 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006235755.1 Gene:Stx16 RGDID:1309423 Length:326 Species:Rattus norvegicus

Alignment Length:371 Identity:142/372 (38%)
Similarity:198/372 (53%) Gaps:67/372 (18%)


  Fly     1 MTSRNLTEVFVIMRNNASKNRNHYDDRRGSDAERLLKHSVREAEEGLELQDD------------- 52
            |.:|.||:.|:::|||:.:||....::..|.......||...|.|..||.||             
  Rat     1 MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHTTSSPLHSRSIAAELDELADDRMALVSGISLDPE 65

  Fly    53 ------YGTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDDECDIEVLSQIVS 111
                  ..:||.|:|..:|.||.:.:||.|:.||.|||.:||.||..||..::|..||:.:|.|:
  Rat    66 AAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMRELASLHDKHLNRPTLDDSSEEEHAIEITTQEVT 130

  Fly   112 KLITSTHRHIQCVRS-SIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYLLQLNSREERS 175
            :|.....|.:|.:.| :....|:.|:.|..|.|......||||:..||.:|:.||.::.:|||||
  Rat   131 QLFHRCQRAVQALPSRARRTCSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERS 195

  Fly   176 QKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDDEQAIDDHFQRP 240
            |.:||           |.|.|.:       |..|..|.       |.|  |.||:          
  Rat   196 QHFFD-----------TPVPLMD-------DGDDATLY-------GQG--FTDDQ---------- 223

  Fly   241 PASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQ 305
                      |:..|:||.|.:.||:|:.:||:||.|||:||:|||.|:.|||||||||||||||
  Rat   224 ----------LVLVEQNTLVVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQ 278

  Fly   306 TQTRVSEGLRQLHKAEMYQRKNRKMCVILVLAAVTFFMLLLLILTK 351
            :..:..:||:||||||.||:|||||.|||:|.||...::::||..|
  Rat   279 SCVKTEDGLKQLHKAEQYQKKNRKMLVILILVAVIVVLIVVLIAVK 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 36/58 (62%)
Stx16XP_006235755.1 SynN 80..>194 CDD:294095 44/114 (39%)
SNARE_syntaxin16 234..292 CDD:277198 36/58 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C67484856
eggNOG 1 0.900 E1_COG5325
Hieranoid 1 1.000
Homologene 1 1.000 H2791
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1182451at2759
OrthoFinder 1 1.000 FOG0003802
OrthoInspector 1 1.000 T1088356
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR19957
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.