DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx16 and Syx4

Sequence 1:NP_523420.1 Gene:Syx16 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_525057.2 Gene:Syx4 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster

Alignment Length:382 Identity:75/383 (20%)
Similarity:136/383 (36%) Gaps:129/383 (34%)


  Fly     7 TEVFVIMRNNASKNRNHYD---------DRRGSDAERLLKHSVREAEEGLELQDDYGTPPAWLDK 62
            |..|:|  .|...|.|.|.         ....|..|...:.|.:..:.|..:.|       .|:.
  Fly    35 TTEFII--GNTGGNNNSYSVVSQNSHSCSNNNSSTEPKDRSSSKMTQYGSNVDD-------ILNP 90

  Fly    63 FEEAQYTMSKIKPKLD-----------------ELGSLHARHL-----LRPAFDDQRDD---ECD 102
            :.|.:..:::|...|:                 |:..||.::|     |...|:|.:.:   |.|
  Fly    91 YTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPAEND 155

  Fly   103 IEVLSQIVSKLITSTHRHIQCVRSSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYLLQ 167
            ..:.:::...|....|:..                  :|..|...|.||....|.:.:     |:
  Fly   156 YSLEARMKRTLFYGLHQTF------------------INLWHKNELFLQNYETKVKKN-----LR 197

  Fly   168 LNSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDS------FDNFLQPPAEGKSGNGYLF 226
            |:::                   ..|.|..||..|..:::      .|||||...:         
  Fly   198 LHTK-------------------IINSEASEQEIELLIENKTTKLFVDNFLQETEK--------- 234

  Fly   227 EDDEQAIDDHFQRPPASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQE 291
                                       |.:..|....|..|:.::.|||.:::.:|..:..:|.|
  Fly   235 ---------------------------ERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVME 272

  Fly   292 QGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNR--KMCVILVLAAVTFFMLLL 346
            |..|:.|::::.:|....|.:|..:|.:||.:|:|.|  |:.:|::||||...:||:
  Fly   273 QSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLIVILAAVLLVLLLV 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 15/58 (26%)
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 42/258 (16%)
SNARE_syntaxin1-like 238..298 CDD:277201 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C67532774
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19957
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.