DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx16 and stx7

Sequence 1:NP_523420.1 Gene:Syx16 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002936355.1 Gene:stx7 XenbaseID:XB-GENE-1004004 Length:259 Species:Xenopus tropicalis

Alignment Length:303 Identity:71/304 (23%)
Similarity:130/304 (43%) Gaps:63/304 (21%)


  Fly    54 GTPPAWL-----DKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDDECDIEVLSQIVSKL 113
            |..||.|     ...::...:.|:|:..:::||::.....||....::          .|...|:
 Frog     6 GQDPAQLAQTISGNIQKITQSSSEIQRIVNQLGTVQDTAELRNRLQEK----------IQYAHKI 60

  Fly   114 ITSTHRHIQCVR--SSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYLLQLNSREERSQ 176
            ...|.|   |::  :|:.:.|...|         ..||...|..:|.:..|.:........|:.:
 Frog    61 AKDTDR---CLKDYASLPLESDQRQ---------RKLQKDRLVSEFSSVLNNFQKIQRQAAEKEK 113

  Fly   177 KYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDDEQAIDDHFQRPP 241
            ::            ...|..|.:.:..|         |....|.|:...:|::.|         |
 Frog   114 EF------------VARVRAGSRVSGGF---------PDDSQKEGSLLTWENEGQ---------P 148

  Fly   242 ASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQT 306
            .:.|.::::   .|::..:.:.||..:.::.:.|..:||||||||.||.|||.::|.|:.|||..
 Frog   149 QATMQEEEI---TEDDLHLIEERETAIRQLEEDIQGINDIFKDLGMMVHEQGEMIDSIEANVENA 210

  Fly   307 QTRVSEGLRQLHKAEMYQRKN-RKMCVILVLAAVTFFMLLLLI 348
            ...|.:..:||.:|..||||: ||:|:|:.:..|...::.|:|
 Frog   211 DVHVQQANQQLARAAEYQRKSRRKICIIIAVLVVAATVIGLII 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 24/58 (41%)
stx7XP_002936355.1 Syntaxin 13..197 CDD:279182 46/239 (19%)
Syntaxin_2 16..116 CDD:291208 20/134 (15%)
SNARE_syntaxin7 165..224 CDD:277228 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3589
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.