DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)G0004 and krr1

DIOPT Version :8

Sequence 1:NP_608387.1 Gene:l(1)G0004 / 33033 FlyBaseID:FBgn0027334 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001038790.2 Gene:krr1 / 724049 ZFINID:ZDB-GENE-060623-10 Length:376 Species:Danio rerio

Alignment Length:186 Identity:38/187 (20%)
Similarity:78/187 (42%) Gaps:18/187 (10%)


  Fly    55 KAKRARSELRKVS----VPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVE----LRVGPE 111
            ||...:..|.:.|    .|.:|.:.|||.|     |:|:....::..|.....:|    :....:
Zfish    42 KADNPKGLLEESSFATLFPKYREAYLKECW-----PLVQKALAELFINATLDLIEGSMTVNTTKK 101

  Fly   112 TPDIANLQRGADFVRAFLCGFEVDDALALLRLEDLFVESFEIKDVKTLRGDHQSRAIGRLAGKGG 176
            |.|..::.|..|.::........:.|:.:|. :|:..:..:|..:...|.....|. .||.|..|
Zfish   102 TFDPYSIIRARDLIKLLARSVPFEQAVRILD-DDMACDIIKIGTLVRNRERFVKRR-QRLIGPKG 164

  Fly   177 RTKFTIENVTKTRIVLADSKIHILGSYQNIQLARRAVCNLILGSPPSKVYGNLRAV 232
            .|...:|.:|...:::..:.:..||.:..::..|:.|.:.:....|  :| |::.:
Zfish   165 STLKALELLTNCYVMVQGNTVSALGPFNGLKEVRKVVLDTMKNIHP--IY-NIKTL 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(1)G0004NP_608387.1 Krr1 61..239 CDD:224019 36/181 (20%)
KH 165..217 CDD:197652 12/52 (23%)
krr1NP_001038790.2 Krr1 47..210 CDD:224019 33/170 (19%)
KH 153..203 CDD:197652 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.