DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17065 and Amdhd2

DIOPT Version :8

Sequence 1:NP_001162805.1 Gene:CG17065 / 33026 FlyBaseID:FBgn0031099 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_766523.2 Gene:Amdhd2 / 245847 MGIID:2443978 Length:409 Species:Mus musculus

Alignment Length:408 Identity:234/409 (57%)
Similarity:299/409 (73%) Gaps:15/409 (4%)


  Fly    21 ASSQRLLQFTNCRLVRDHRIIHDDLWVRDGRIVNPEPVFFDERTKAHCRIDCGGAIIAPGYIDLQ 85
            |:...:|||||||::|...::.:|||||.|||::||.:||:||..|..:.||||.|:|||:||:|
Mouse     7 AAGAPVLQFTNCRILRGGTLLREDLWVRGGRILDPEKLFFEERRVADEQRDCGGRILAPGFIDVQ 71

  Fly    86 INGGYGVDFSYDTETIEEGVATVARGLVKSGVTSFCPTLVTSPSDSYHTILPRIPAEV--PKGAG 148
            ||||:|||||..||.:..|||.|||.|:..|||||||||||||.:.||.:||:||.:.  |.|||
Mouse    72 INGGFGVDFSKATEDVGSGVALVARRLLSHGVTSFCPTLVTSPPEVYHKVLPQIPVKSGGPHGAG 136

  Fly   149 ILGIHAEGPFINPQKKGAHPEHCIQTIDKRDHSNVTFRLPRLKGLSTLKETYGSLERIKIITLAP 213
            :||:|.|||||:.:|:|||||..:::.:.....:|.             .|||.|:.:.|:||||
Mouse   137 VLGVHLEGPFISREKRGAHPEAYLRSFEANAFHDVL-------------ATYGPLDNVCIVTLAP 188

  Fly   214 EKVTDPEVIGQLVERGITVALGHSMASLSDGERAVQQGATLITHLFNAMLPFHHRDPGLVGLLAS 278
            |.....|||..|..:||.|:||||:|.|...|.|||.|||.|||||||||||||||||:||||.|
Mouse   189 ELDRSHEVIQALTAQGIRVSLGHSVADLRAAEVAVQSGATFITHLFNAMLPFHHRDPGIVGLLTS 253

  Fly   279 DAVPHGRTVYFGIISDGVHTHPAALRIAYRTHPQGLILVTDAISALGLEEGVHHIGQLPLQVKQG 343
            |.:|.|..:::|:|:||:||:|||||||:|.|||||:|||||:.||||..|.|.:||..::|...
Mouse   254 DQLPPGHCIFYGMIADGIHTNPAALRIAHRAHPQGLVLVTDAVPALGLGNGRHTLGQQEVEVDGL 318

  Fly   344 KAFIAGTETLCGSIAPMDECVRIFQKATDCSVVYAIEAATLHPAQCLKIEKQKGTLDFGSDADFV 408
            .|:||||:||.|||||||.|||.|.:||.|||..|:|||:|||||.|.:||.||:||||:|||||
Mouse   319 IAYIAGTKTLGGSIAPMDVCVRHFLQATGCSVESALEAASLHPAQMLGLEKTKGSLDFGADADFV 383

  Fly   409 LLDDQLRVLSTWIAGVCV 426
            :|||.|.|.:|:|:|..|
Mouse   384 VLDDTLHVQATYISGELV 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17065NP_001162805.1 NagA 27..423 CDD:238434 231/398 (58%)
HutI 38..431 CDD:224149 225/392 (57%)
Amdhd2NP_766523.2 NagA 13..398 CDD:238434 231/398 (58%)
HutI 31..401 CDD:224149 223/383 (58%)
Substrate binding. {ECO:0000250|UniProtKB:P0AF18} 154..155 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P0AF18} 235..236 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P0AF18} 269..272 2/3 (67%)
Substrate binding. {ECO:0000250|UniProtKB:P0AF18} 328..330 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248870332
eggNOG 1 0.900 E1_COG1820
Hieranoid 1 1.000
Homologene 1 1.000 H9311
Inparanoid 1 1.050 464 1.000 Inparanoid score I1528
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006015
OrthoInspector 1 1.000 T1084801
orthoMCL 1 0.900 OOG5_128970
Panther 1 1.100 LDO PTHR11113
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4676
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.