DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and obst-I

DIOPT Version :8

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_728731.1 Gene:obst-I / 317966 FlyBaseID:FBgn0052304 Length:219 Species:Drosophila melanogaster

Alignment Length:262 Identity:54/263 (21%)
Similarity:81/263 (31%) Gaps:86/263 (33%)


  Fly     3 RFQVCSVLILAWIACGHALAVGS----------PECPEKY----GVQAYAHTE--NC-------- 43
            |..:|.:..|.: ..|..|..||          ..||:.|    .:||...|:  :|        
  Fly     5 RLIICLLTFLLF-QTGKGLGNGSYLELRLDAAAESCPDDYYFNETIQACVSTDTTSCTNHQIGKC 68

  Fly    44 ------DQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWDPTPISTPACEYQF 102
                  |:|.:|.:..|.:..|..|..||....|   |... :|:|   |.|.||...|      
  Fly    69 PMATEMDEFCVCKDKHLQIWKCPEGTYFDANRLV---CRVG-SVEC---QDDYTPSPCP------ 120

  Fly   103 GLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGC----NWPDQLLE---HCNPEAVVGFK 160
                 :...|..:..|..|:.|...|..|..:|:.:..|    :..|:|..   .|....:.|  
  Fly   121 -----NSTASDVFCLCIDGKWHLNYCPTGFTFDDELQICLNTGSDDDELPSSSGKCQRLGLFG-- 178

  Fly   161 CPTKVDPNSVAARFWPFPRFPVAGDCHRLITCVE--GHPRLISCGEDKVFDEHTLTCEDPEYASG 223
                 ||                .||.....|.|  .......|....:|:..:..|     .:|
  Fly   179 -----DP----------------ADCSGYYHCREKGSDIEYFRCSVGTIFNLISFAC-----VTG 217

  Fly   224 SC 225
            :|
  Fly   218 TC 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 14/63 (22%)
CBM_14 103..147 CDD:279884 9/48 (19%)
ChtBD2 179..218 CDD:214696 7/41 (17%)
obst-INP_728731.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.