DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pico and grb10b

Sequence 1:NP_608363.1 Gene:pico FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:XP_021322523.1 Gene:grb10b ZFINID:ZDB-GENE-091020-12 Length:595 Species:Danio rerio

Alignment Length:517 Identity:142/518 (27%)
Similarity:213/518 (41%) Gaps:88/518 (17%)


  Fly   275 SDTVSLLSSESSASSNTS-LQQQQQQQQQQHHQHQQ---HHQHQQQQQKPQLAGAEKLHHHGVHG 335
            |...||.:|.|..|.:|. |...|..:...:|.|.|   .||..::.|...:....:|       
Zfish    64 SSLESLYTSCSVQSESTPLLHNGQPHRPSAYHTHAQPISPHQRLRRSQPMNILAVRRL------- 121

  Fly   336 QHGGQQSGANSI-----------TKADKIQLALHKL-ESAPIRRLFVKAFTSDGASKSLLVDERM 388
            |...||...:|:           :.|....|:...| :..|..:..:|.|:.||..|.:.:...|
Zfish   122 QEEAQQYRTSSLPAIPNPFPELCSPASSPTLSSGSLPQCQPSDKYIIKIFSEDGMGKVVEIPADM 186

  Fly   389 GCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDK 453
            ....:.:.|..|||....::||||||...|.:||..|||||:|....:..|:  ::.||::...|
Zfish   187 TARDLCQFLVYKNHCVDDNSWALVEHHPALGLERCLEDHELVVQVQTSMISE--SKFLFRKNYAK 249

  Fly   454 VTLFLRPELYLPGPQMAPGCQHDEQT--RQMLLDEFFDSHNQLQMDGPLYMKADPKKGWKRYHFV 516
            ...|..|..:.| .||...||....|  ...||..|.:|.:..::.|.||:|...:|.||:.:..
Zfish   250 YEFFKNPLNFFP-EQMIAWCQETNGTIPPSQLLQNFLNSSSCPEIQGYLYVKEMGRKSWKKLYVF 313

  Fly   517 LRSSGLYYFPKEKTKNTRDLACLNLFHGHNVYTGLGWRKKWKSPTDYTFGFKAVGDSSLGKSCRS 581
            ||.||||:..|..:|..|.|..|......||:|.:..||...:|||:.|..|   .:.:....:.
Zfish   314 LRRSGLYFSTKGTSKEPRHLQLLADLEDSNVFTVITGRKLHSAPTDFEFCIK---PNKVRNEVKE 375

  Fly   582 LKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHKSLLEDLCLSRDDAVSQSSFAASMRSESISS-- 644
            |:||||||..:...|:||.|:.|||..|:.::|       :.:......|.|:|.:||.|.||  
Zfish   376 LRMLCAEDEQSRTCWMTAFRLFKYGILLYQNYK-------IHQQRKTLLSHFSAPVRSVSESSLV 433

  Fly   645 -----------ISSAVPSQ--------------------CGSVS----SAISSMSNSTS----GR 670
                       |.:.|.:|                    .||.|    |::|.:.:.|.    ||
Zfish   434 AMDFSGRIGRVIDNPVEAQSAAMEEGHAWRKKSQQRMNILGSPSSLHPSSLSGVIHRTQLWFHGR 498

  Fly   671 TSRASSSSSSGCLSDDNNAFDSEFTTGTIKRKPSMKPNLPLTTMTRQLK-EVGEITICESAG 731
            .||..|..    |.......|..|    :.|.....|...:.|:....| :..:|.:||..|
Zfish   499 ISREESHK----LIHQQGRVDGMF----LLRDSQSNPKAFVLTLCHHQKIKHFQILLCEEDG 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 29/87 (33%)
PH_APBB1IP 489..614 CDD:269961 44/125 (35%)
PH 494..605 CDD:278594 40/111 (36%)
grb10bXP_021322523.1 GRB7_RA 165..246 CDD:176382 28/83 (34%)
PH_APBB1IP 286..408 CDD:269961 44/125 (35%)
BPS 426..470 CDD:312490 7/44 (16%)
SH2_Grb10 488..595 CDD:198278 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96279021
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.