DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pico and raph1b

Sequence 1:NP_608363.1 Gene:pico FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001352514.1 Gene:raph1b ZFINID:ZDB-GENE-090311-54 Length:1565 Species:Danio rerio

Alignment Length:1241 Identity:320/1242 (26%)
Similarity:482/1242 (39%) Gaps:330/1242 (27%)


  Fly    95 VIGAGAGAGVKLRRHSD---------RPLTPEAKQLSHTYRISMANLEDS----QESELDQILGE 146
            :.||..|...||.:..|         .||..|....:.:||.||.|:.::    :..:||.::.:
Zfish    27 MFGAWLGELDKLTQSLDDGRPEKVQKAPLRQETNLANFSYRFSMYNINEAINQGETVDLDALMAD 91

  Fly   147 LSLLEAQISYTEASMLPAMCAPSAGAQIAPPPGVTQLPGSA---PTMVSMSASSSRSHSRTNSTI 208
            |..:|.::|                 .|..|...| |.|.:   ||..|.||..|...|...||.
Zfish    92 LCSIEQELS-----------------TIGKPISKT-LDGKSKQRPTGRSASAKHSGGGSSGGSTS 138

  Fly   209 SADVSSCSSSGISENGHGLGLVLG--------------------------GPGSAGMMVQPPPPG 247
            |:..:|.:|:....|.....|...                          ...|:.....||...
Zfish   139 SSTRASPASTVRGGNSQSRPLASNFSLDDITAQLEKASLSMDEAAKQTSESSSSSYSSANPPSNS 203

  Fly   248 GMTMGITLGVVTPREPRTESPDNDSAFSDTVSLLSSESSASSNTSLQ-QQQQQQQQQHHQHQQHH 311
            ......::|.|:.:|.|:....:.|:.        :.:||||..||. :.|:.:.|..:|.|...
Zfish   204 HHRRTGSVGTVSDQEVRSIGHSSRSSV--------NSASASSMDSLDIRGQENETQSQNQSQTST 260

  Fly   312 QHQQQQQKPQLAGAEKLHHHGVHGQHGGQQSGANSI----------------------------T 348
            :|...:   :..|.....|.....|.|......:|.                            .
Zfish   261 EHVLLR---RANGKTTRRHLDFTSQEGEVDQSTHSYLDRETSLILKNIAGKPSHLLTKEEQAAKA 322

  Fly   349 KADKIQLALHKLESAPIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVE 413
            ||:||::||.|::.|.:::|.::...||.:||:::||||.....:...|.||:|.....:|||||
Zfish   323 KAEKIRVALEKIKEAQVKKLVIRVHMSDESSKTMMVDERQTVRQLLDSLLDKSHCGYSPDWALVE 387

  Fly   414 HLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPG----PQMAPGCQ 474
            .:.:|||||:|||||.||:||:.|..|:.|:::|.:|.:|..||..|:.||.|    .:||    
Zfish   388 TIPELQMERIFEDHENLVENLLNWTRDSQNKLMFIERIEKYALFKNPQNYLLGRKETSEMA---- 448

  Fly   475 HDEQTRQMLLDEFF--DSHNQLQMDGPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRDLA 537
              ::.::.||:|.|  .|.:..:::|.|::|.|.||.||:.:|:||:||:|:.||.|.|.:|||.
Zfish   449 --DRNKEALLEECFCGSSVSVPEIEGVLWLKEDGKKSWKKRYFLLRASGIYFVPKGKAKASRDLV 511

  Fly   538 C-LNLFHGHNVYTGLGWRKKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIR 601
            | |.|.| .|||.|..:|.|:|:||||....|   ...:.|..:.:|.||.:|:.||.:|:..||
Zfish   512 CFLQLDH-VNVYYGQDYRSKYKAPTDYCLALK---HPQIQKKSQYIKYLCCDDVRTLHQWVNGIR 572

  Fly   602 VCKYGKQLWDSHKSLLEDLCLSRDDAVSQSSFAASMRSESISSISSAV---PSQCGSVSSAISSM 663
            :.||||||:.:::.     .:.|.:|....|   |:.|.||.|.:|:|   .||....|...|.|
Zfish   573 IAKYGKQLYVNYQE-----AMKRTEAAYDWS---SLSSTSIKSGTSSVSIPESQSNHSSQTDSGM 629

  Fly   664 SNSTSGRTSRASSSSSSGCLSDDNNAFDSEFTTGT-IKRKPSMKPNLPLTTMTRQLKEVGEITIC 727
            |:.||...:|:.|..||        .|...:..|| |:.....:|....:|.:........ .:.
Zfish   630 SDGTSSSHARSQSVVSS--------IFSEAWKRGTQIEESTKARPESIRSTHSSHSSHSSH-HVS 685

  Fly   728 ESAGGDASSPERSGTLTRRHSRRKSQESNGSGTLKRRPIAV-----------------PVATVVK 775
            :.....|..|.....|..|.|..::.....:.||.:.|..|                 |::::..
Zfish   686 QQQHLHAQQPHVHSILQSRGSVTQAPAQAPTQTLAQAPPQVAPAPPPPPPPPPPPPPPPISSIPH 750

  Fly   776 QTEP-MGSASST------SSSSNSTPTPTPSICAKPPPGDSASLMCSSTL-SLDSLPPPPPPPAL 832
            ...| |.:..||      :|.:.|...|.|.|..:.||....|...|:.: |..::|||||||  
Zfish   751 HATPTMFAKYSTITRLQNASQATSHHKPQPQIQQQVPPVPPPSKPQSNNIPSGANIPPPPPPP-- 813

  Fly   833 DGSEDQDVYGSQLSLASLPPP----------PPPEDVLAMNYAEPSSPSTPTPMSTPMIMPNSNG 887
                         ..||:|||          ||...|:..  ..||.||.|.|...|.|||..:.
Zfish   814 -------------PPASMPPPGSAMAVLKLGPPAAAVIPQ--ISPSPPSPPPPPPPPPIMPVQSQ 863

  Fly   888 SLPPAVPAKPMK--------PAVKQAAGGLKAAPPYKA----PPDYVGP----ALLPGPP----- 931
            ..||..|..||:        |.....:..|...||.::    ||..:.|    ||.|.||     
Zfish   864 PQPPPPPIMPMQSQPLPPPPPITPMQSHNLPPPPPMQSHALPPPPPITPMQSHALPPPPPITPMQ 928

  Fly   932 ---LPPPPPAQKKVSFADSPVLLRRKMCSPEPVLPQRS-----PSTTLSCHSSSSAGSAYQTYAP 988
               ||||||.....|.|..|         |.|:.|.:|     |...:...|......|......
Zfish   929 SHALPPPPPITPMQSHALPP---------PPPITPMQSHALPPPPPIMPMQSEPLPPPAQIMPMQ 984

  Fly   989 GPMLPPRADVARLSS---------LSNGSSSEVTSPKRLQESASNPPRDFLKD-LQRVMRKKWQV 1043
            ...|||...:.::.|         :|..|......|..||.:...||...:.: |::....|:  
Zfish   985 SHPLPPPPPLVQMQSQPMPPPPPTVSFQSQPLPPPPPPLQANGLPPPPPLITNGLKQAFAHKF-- 1047

  Fly  1044 AQKCKAEPATTPHEVLGFRDFSNEDLLAAHNLNSGANSSHY------------------YRETAN 1090
                    .:||.:||                 ..||.:::                  |:...:
Zfish  1048 --------PSTPQDVL-----------------PPANQNNFPPPPPPPPPPPLAPTLPPYQHVTS 1087

  Fly  1091 VSHWVRKHYEYAHNALYENVHAQSAAAAGVPGSGEATTPPLPPPPGNSVAAKKRPPPPPPKRSDK 1155
            .|:                                   ||.||||         ||||||.   .
Zfish  1088 TSN-----------------------------------PPPPPPP---------PPPPPPA---P 1105

  Fly  1156 THLTNR 1161
            .||.|:
Zfish  1106 IHLANQ 1111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 37/87 (43%)
PH_APBB1IP 489..614 CDD:269961 54/126 (43%)
PH 494..605 CDD:278594 48/112 (43%)
raph1bNP_001352514.1 UBQ 340..421 CDD:320785 35/81 (43%)
PH_APBB1IP 463..585 CDD:269961 54/126 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96321700
eggNOG 1 0.900 E1_KOG3751
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 317 1.000 Inparanoid score I2481
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002124
OrthoInspector 1 1.000 T597842
orthoMCL 1 0.900 OOG5_132886
Panther 1 1.100 O PTHR11243
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2645
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.