DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pico and Apbb1ip

Sequence 1:NP_608363.1 Gene:pico FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_062329.2 Gene:Apbb1ip MGIID:1861354 Length:670 Species:Mus musculus

Alignment Length:960 Identity:235/961 (24%)
Similarity:360/961 (37%) Gaps:350/961 (36%)


  Fly   134 DSQESELDQ----ILGELSLLEAQISYTEASMLPAMCAPSAGAQIAPPPG-------VTQLPGSA 187
            :|.| ::||    :|||:.||                ..|.|....|||.       .....|..
Mouse     3 ESNE-DIDQMFSTLLGEMDLL----------------TQSLGVDTLPPPDPNPPREEFNYTVGFK 50

  Fly   188 PTMVSMSASSSRSHSRTNSTISADVSSCSSSGI------SEN---------GHGLGLVLGGPGSA 237
            ....|::|...:......:.:.||:|......|      |:|         ..|.|...||.|::
Mouse    51 DLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESSQNQDRFALLRASDGQGTASGGYGAS 115

  Fly   238 GMMVQ--------PPPPGGMTMGITLGVVTPREPRTESPDNDSAFSDTVSLLSSESSASSNTSLQ 294
            ...:.        ||||....:.:     .|..|....|:          |||.|          
Mouse   116 AAAIDVSHHEEALPPPPVEPMLDL-----LPPPPPPPPPE----------LLSKE---------- 155

  Fly   295 QQQQQQQQQHHQHQQHHQHQQQQQKPQLAGAEKLHHHGVHGQHGGQQSGANSITKADKIQLALHK 359
                                :::.|                            .|||||:|||.|
Mouse   156 --------------------EEEAK----------------------------AKADKIKLALEK 172

  Fly   360 LESAPIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLF 424
            |:.|.:::|.||....|.::|||:||||.....|...|.:|.|.....:|.|.|...:||:||:|
Mouse   173 LKEAKVKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVF 237

  Fly   425 EDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPE-LYLPGPQMAPGCQHDEQT--------R 480
            ||||.:|:.|..|..|..|:|||.::.::..:|..|: .||..    .|.:.:::|        :
Mouse   238 EDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLDN----KGKKENKETNEKMNAKNK 298

  Fly   481 QMLLDEFFDSHNQL--QMDGPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRDLACLNLFH 543
            :.||:|.|...:.:  :::|.||:|.|.||.|||.:|:||:||:||.||.|||.:|||||...|.
Mouse   299 EYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE 363

  Fly   544 GHNVYTGLGWRKKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQ 608
            ..|:|.|:..:.|:|:|||:.|..|   ...:.|..:.:|.||.:|..||.:|:..||:.||||.
Mouse   364 NVNIYYGIQCKMKYKAPTDHCFVLK---HPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKT 425

  Fly   609 LWDSHKSLLEDLCLSRDDAVSQSSFAASMRSESISSISSAVPSQCGSVSSAISSMSNSTSGRTSR 673
            |:|:::.           ||:::..|:  |..::.::.:.:|:|..:|||.:.:.::..:|:..:
Mouse   426 LYDNYQR-----------AVARAGLAS--RWTNLGTVGTPMPAQPSTVSSGLKTGTSQPNGQMPQ 477

  Fly   674 ASSSSSSGCLSDDNNAFDSEFTTGTIKRKPSMKPNLPLTTMTRQLKEVGEITICESAGGDASSPE 738
            |.                           ||..|  ||.....|:    |.|..|..|....|| 
Mouse   478 AI---------------------------PSAGP--PLQEAQTQI----ETTKDEKQGLGNHSP- 508

  Fly   739 RSGTLTRRHSRRKSQESNGSGTLKRRPIAVPVATVVKQTEPMGSASSTSSSSNSTPTPTPSICAK 803
               ..||.:.|.||.            :..|...|.:.::..||.:..|....      |..|..
Mouse   509 ---GATRENHRPKSS------------LPPPPPPVRRSSDTCGSPALPSKVKG------PGTCTF 552

  Fly   804 PPPGDSASLMCSSTLSLDSLPPPPPPPALDGSEDQDVYGSQLSLASLPPPPPPEDVLAMNYAEPS 868
            |.|.:            :.||||||||.   .||.         :.|.|||||            
Mouse   553 PHPPE------------NFLPPPPPPPP---EEDN---------SGLLPPPPP------------ 581

  Fly   869 SPSTPTPMSTPMIMPNSNGSLPPAVPAKPMKPAVKQAAGGLKAAPPY-KAPPDYVGPALLPGPP- 931
                                                        ||| :.|||:|.|   |.|| 
Mouse   582 --------------------------------------------PPYLEEPPDFVPP---PPPPA 599

  Fly   932 ------LPPPPPAQKKVSFADSPVLLRRKMCSPEPVLPQRSPSTTLSCHSSSSAGSAYQTYAPGP 990
                  ||||||         .|..|.:::....|:.|::                        |
Mouse   600 AVEDSALPPPPP---------PPPCLSQEITKSSPLPPKK------------------------P 631

  Fly   991 MLPPRADVARLSSLSNGSSSEVTSPKRLQESASNPPRDFLKDLQRVMRKK 1040
            ::||:..                ..:.|..:..|..:||:.||.:.::||
Mouse   632 LVPPKRQ----------------ENQGLPGAPGNSEQDFMSDLMKALQKK 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 35/87 (40%)
PH_APBB1IP 489..614 CDD:269961 54/127 (43%)
PH 494..605 CDD:278594 49/113 (43%)
Apbb1ipNP_062329.2 GRB7_RA 186..264 CDD:176382 32/78 (41%)
PH_APBB1IP 310..431 CDD:269961 54/124 (44%)
PH 314..422 CDD:278594 49/111 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96337396
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002124
OrthoInspector 1 1.000 T616955
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11243
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.