DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pico and grb10a

Sequence 1:NP_608363.1 Gene:pico FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001004287.1 Gene:grb10a ZFINID:ZDB-GENE-040822-32 Length:602 Species:Danio rerio

Alignment Length:493 Identity:124/494 (25%)
Similarity:199/494 (40%) Gaps:98/494 (20%)


  Fly   259 TPREPRTESPDNDSAFSDTVSLLSSES----------------SASSNTSLQQQQQQQQQQHHQH 307
            :|..|. :..|.::..:|..||.|.||                .::.::.|...:.....:...|
Zfish    43 SPNHPE-DDVDLEALVNDMASLSSYESIYATCEIQHSDSAPLLHSTDSSGLHGNRVAPLPRAPSH 106

  Fly   308 QQHHQHQQQQQKPQLAGAEKLHHHGVHGQHGGQQSGANSITKADKIQLALHKLES---------- 362
            :....|...|   :|..::.:|.|.|..            .:.:::|:....|.:          
Zfish   107 KVTAPHSPAQ---RLRRSQPMHIHAVRR------------LQEEELQVRPASLPAIPNPFPELCS 156

  Fly   363 -------------APIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEH 414
                         .|.....:|.|:.||..|.:.|...|....|.:.|..|:|....:.|:||||
Zfish   157 PSGSPVLSPGSLPQPSESHIIKVFSEDGVGKVVEVTAGMMARDVCQFLVYKSHCLDDNCWSLVEH 221

  Fly   415 LGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQHDEQT 479
            ...|.:||..|||||:|........:  ::.||::...|...|..|..:.| .||...||....:
Zfish   222 HSLLGLERCLEDHELVVSVKACMPPE--SKFLFRKNYAKYEFFRNPLNFFP-EQMVAWCQESNGS 283

  Fly   480 --RQMLLDEFFDSHNQLQMDGPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRDLACLNLF 542
              :..||..|.:|.:..::.|.||||...:|.||:.:..||.|||||..|..:|..|.|..|:..
Zfish   284 IPQSQLLQNFLNSSSCPEIQGFLYMKETGRKSWKKLYMFLRRSGLYYSTKGMSKEPRHLQLLSDL 348

  Fly   543 HGHNVYTGLGWRKKWKSPTDYTFGFKAVGDSSLGKS-CRSLKMLCAEDLPTLDRWLTAIRVCKYG 606
            ...|::|....||...:||||.|..|    .|.|:: .:.||||||||..:...|:||.|:.|:|
Zfish   349 EESNIFTVTTGRKMHNAPTDYQFCIK----PSKGRTELKELKMLCAEDEQSRTCWMTAFRLLKFG 409

  Fly   607 KQLWDSHKSLLEDLCLSRDDAVSQSSFAASMRSESISSISSAVPSQCGSVSSAISSMSNSTSGRT 671
            ..|:.::|:..:...:        |:|...:||.|.:|:                 ::...||||
Zfish   410 ILLYQNYKTPHQRKTI--------SNFTTPVRSVSENSL-----------------VAMDFSGRT 449

  Fly   672 SRASSSSSSGCLSDDNNAFDSEFTTGTIKRKPSMKPNL 709
            .|.        :.:...|..:....|...||.|.:.|:
Zfish   450 GRV--------IDNPVEAQSAAMEEGHTWRKRSQRMNV 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 28/87 (32%)
PH_APBB1IP 489..614 CDD:269961 48/126 (38%)
PH 494..605 CDD:278594 45/112 (40%)
grb10aNP_001004287.1 UBQ 175..255 CDD:294102 27/82 (33%)
PH_APBB1IP 295..417 CDD:269961 48/126 (38%)
PH 300..407 CDD:278594 44/111 (40%)
BPS 434..474 CDD:286088 12/65 (18%)
SH2_Grb10 495..602 CDD:198278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96279047
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.