DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pico and Raph1

Sequence 1:NP_608363.1 Gene:pico FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001102268.2 Gene:Raph1 RGDID:1308387 Length:1266 Species:Rattus norvegicus

Alignment Length:1290 Identity:332/1291 (26%)
Similarity:508/1291 (39%) Gaps:392/1291 (30%)


  Fly    95 VIGAGAGAGVKLRR--HSDRPLTP--------EAKQLSHTYRISMANLEDS----QESELDQILG 145
            :.||..|...:|.:  .||:|..|        |....:.:||.|:.||.::    :..:||.::.
  Rat    27 MFGAWLGELDRLTQSLDSDKPKEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMA 91

  Fly   146 ELSLLEAQISYTEASMLPAMCAPSAGAQIAPPPGVTQLPGSA-----PTMVSMSASSSRSHSRTN 205
            :|..:|.::|        ::.:.::..|:..|....:||.|.     .|:..:|:||:|:....:
  Rat    92 DLCSIEQELS--------SVGSGNSKRQVTEPKVAQKLPASRHTSKHGTLRGVSSSSTRTTRPPH 148

  Fly   206 STISADVSSCSSSGISENGHGLGLVLGGPGSAGMMVQPPPPGGMTMGITLGVVTPREPRTESPDN 270
            :..|.|..:......|     |.:......||....:||.........:.|.|:..|.|:.|  |
  Rat   149 ANYSLDDITAQLEQAS-----LSMDEAAQQSAVEDAKPPATNQHRRTASAGTVSDAEVRSVS--N 206

  Fly   271 DSAFSDTVSLLSSESSASSNTSLQQQQQQQQQQ----HHQHQQHHQHQQQQQKPQLAGAEKLHHH 331
            .|..|.|       |:|||..||...:..:.|:    .||.:...:.:|         |.||   
  Rat   207 SSRSSIT-------SAASSMDSLDIDKVTRPQELDLTAHQGKPITEEEQ---------AAKL--- 252

  Fly   332 GVHGQHGGQQSGANSITKADKIQLALHKLESAPIRRLFVKAFTSDGASKSLLVDERMGCGHVTRL 396
                             ||:||::||.|::.|.:::|.::...||.:||:::||||.....|...
  Rat   253 -----------------KAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDN 300

  Fly   397 LADKNHVQMQSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPE 461
            |.||:|.....:|:|||.:.:|||||:|||||.||:||:.|..|:.|:::|.:|.:|..||..|:
  Rat   301 LMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQ 365

  Fly   462 LYLPG----PQMAPGCQHDEQTRQMLLDEFF--DSHNQLQMDGPLYMKADPKKGWKRYHFVLRSS 520
            .||.|    .:||      ::.:::||:|.|  .|....:::|.|::|.|.||.||:.:|:||:|
  Rat   366 NYLLGKKETAEMA------DRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRAS 424

  Fly   521 GLYYFPKEKTKNTRDLAC-LNLFHGHNVYTGLGWRKKWKSPTDYTFGFKAVGDSSLGKSCRSLKM 584
            |:||.||.|.|.:|||.| |.|.| .|||.|..:|.|:|:|||.....|   ...:.|..:.:|.
  Rat   425 GIYYVPKGKAKVSRDLVCFLQLDH-VNVYYGQDYRNKYKAPTDCCLALK---HPQIQKKSQYIKY 485

  Fly   585 LCAEDLPTLDRWLTAIRVCKYGKQLWDSHKSLLEDLCLSRDDAVSQSSFAASMRSESISSISSAV 649
            ||.:|..||.:|:..||:.||||||:.:::           :|:.::..|....|.|.|||.|  
  Rat   486 LCCDDARTLHQWVNGIRIAKYGKQLYTNYQ-----------EALKRTESAYDWTSLSSSSIKS-- 537

  Fly   650 PSQCGSVSSAI-SSMSNSTSGRTSRASSSSSSGCL---SDDNNAFDSEFTTGTIKRKPSMKPNLP 710
                ||.||:| .|.||.::...|..|.:..||.:   |..::.|...:..|| :.:.|.|..:.
  Rat   538 ----GSSSSSIPESQSNHSNQSDSGVSDTLPSGHIRSQSTVSSIFSEAWKRGT-QLEESSKARME 597

  Fly   711 ---------LTTMTRQLKEVGEITICE--------------------------------SAGGDA 734
                     :..::.|.|.:...|..:                                |:|..|
  Rat   598 SMNRSYTSLMPPLSPQTKIITPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSSGSAA 662

  Fly   735 SSPERSGTLTRRHSRRKSQESNGSGTLKRRP-----------------IAVPVATVV-------- 774
            :...:..|:||..:     .:..||||.:.|                 |.||...|:        
  Rat   663 TMFVKYSTITRLQN-----AAQHSGTLFKSPAPSAMQPLPLASQSKAQIVVPPNGVIPPPPPPPP 722

  Fly   775 --------KQTEPMGSASSTSSSSNS------------------TPTPTPSICAKPPP------- 806
                    .|.:|:..|.|....|..                  ||...|.|.|..||       
  Rat   723 PPTPGSAMAQLKPVPCAPSLPQFSPQPPPLKIHQVQHLPQAAPPTPPAAPLIPATVPPQAPPKPL 787

  Fly   807 ---GDSASLMCSSTLSLDSLPPPPPPPALDGSEDQDVYGSQLSLASLPPPPP------PEDVL-- 860
               ..|||....|.:...::||.|.|| :..::.|.|:    .::.:||.||      |...|  
  Rat   788 VTIPPSASTKMVSPVVAQAVPPTPAPP-VPPTKKQPVF----PVSHIPPTPPVQPTPHPPPTLPK 847

  Fly   861 --AMNYAEPSSPSTPTP-----MSTPMIMPNSNGSLPPAVPAKPMKP----AVKQAAGGLKAAPP 914
              :.....|.||.:|.|     |::....|.:    ||.|.::|:||    ...|:...:||.|.
  Rat   848 QQSFGVKPPPSPLSPVPSVVKQMASQFPPPPT----PPPVDSQPLKPLPASVTPQSPPAVKAKPK 908

  Fly   915 YK-----AP-PDY--------------VGPALLPGPPLPPPPPAQKKVSFADSPVLLRRKMCSPE 959
            ::     || ||:              ..||.:|.||.|||||.                  .|.
  Rat   909 WQPSSIPAPSPDFPPPPPESSLVFPPPPPPAPVPPPPPPPPPPP------------------PPP 955

  Fly   960 PVLPQRSPSTTLSCHSSSSAGSAYQTYAPGPMLPPRADVARLSSLSNGSSSEVTSPKRLQESASN 1024
            ||.|..||:..   ...|......:..:||...||... .|.||:.:||.:|...|||       
  Rat   956 PVSPMASPTPD---KGGSPGKKTSKMSSPGGKKPPPTP-QRNSSIKSGSCAEHPEPKR------- 1009

  Fly  1025 PPRDFLKDLQRVMRKKWQVAQKCKAEPATTP-----HEVLGFRDFSNEDLLAAHNLNSGANSSHY 1084
            |..|.|........:....:::....||..|     |                   .||.|    
  Rat  1010 PSVDSLVSKFAPPAESGSPSKETPPPPAAPPKPGKLH-------------------LSGVN---- 1051

  Fly  1085 YRETANVSHWVRKHYEYAHNALYENVHAQ---SAAAAGVPGSG-----EATTPP----LPPPP-- 1135
                                  ...:|.|   ||..:.:.|.|     |..:||    .||||  
  Rat  1052 ----------------------LPGIHQQGILSAKPSVLSGRGKDAVVEFPSPPSDSDFPPPPPE 1094

  Fly  1136 ---------------GNS----------------VAAKKRPPPPPPKRSDKTHLT 1159
                           ||:                .:.||.|||..|||:|.|.||
  Rat  1095 IELPLPPIEIPAVFSGNTSPKVAVVNPQPQLWSKTSVKKAPPPTRPKRNDSTRLT 1149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 37/87 (43%)
PH_APBB1IP 489..614 CDD:269961 54/126 (43%)
PH 494..605 CDD:278594 48/112 (43%)
Raph1NP_001102268.2 UBQ 270..351 CDD:294102 35/81 (43%)
PH_APBB1IP 393..515 CDD:269961 54/126 (43%)
PH 398..506 CDD:278594 48/112 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96324444
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132886
Panther 1 1.100 O PTHR11243
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.