DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pico and apbb1ip

Sequence 1:NP_608363.1 Gene:pico FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001096403.1 Gene:apbb1ip XenbaseID:XB-GENE-950410 Length:658 Species:Xenopus tropicalis

Alignment Length:928 Identity:228/929 (25%)
Similarity:345/929 (37%) Gaps:294/929 (32%)


  Fly   132 LEDSQESELDQILGELSLLEAQISYTEASMLPAMCAPSAGAQIAPPPGVTQLPGSAPTMVSMSAS 196
            :||..|. ...:|||:.||...:   |...||......:..:|....|...|      ..|::|.
 Frog     1 MEDIDEM-FSNLLGEMDLLTQSL---EIDTLPPPTRSESTTEINFSVGFKDL------NESLNAL 55

  Fly   197 SSRSHSRTNSTISADVSSCSSSGISENGHGLGLVLGGPGSAGMMVQPPPPGGMTMG-ITLGVVTP 260
            .........:.:.||::....:..:.|............|.....||||...:..| ::|   .|
 Frog    56 EDNDLDALMAELVADITDAEQNIATYNNKSTAPFPPVDASNNYNFQPPPIPSLIAGDLSL---PP 117

  Fly   261 REPRTESPDNDSAFSDTVSLLSSESSASSNTSLQQQQQQQQQQHHQHQQHHQHQQQQQKPQLAGA 325
            ..|..|                              ||.....|:...:....::.:.|      
 Frog   118 PPPEFE------------------------------QQYPPPPHYPPTEPKTQEELESK------ 146

  Fly   326 EKLHHHGVHGQHGGQQSGANSITKADKIQLALHKLESAPIRRLFVKAFTSDGASKSLLVDERMGC 390
                                  .|.|||:|||.|::.|.:::..||...:||::|:|:|||....
 Frog   147 ----------------------AKTDKIKLALSKMKEAKVKKRIVKIHMTDGSTKTLMVDELQAV 189

  Fly   391 GHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVT 455
            ..|...|.:|.|......|:|.|.:.:||:||.|||||.:|:.|..|..|:.|.:.|.|:.:|..
 Frog   190 RDVLDNLFEKTHCDCSIEWSLFEVIPELQIERFFEDHENVVELLSDWTRDSENTINFLQKNEKYA 254

  Fly   456 LFLRPE-LYLPGPQMAPGCQHDEQTRQMLLDEFFDSHNQL--QMDGPLYMKADPKKGWKRYHFVL 517
            :|..|: .|:.....|.....:|:.:..||::.|...:.:  :::..||:|.|.||.||:.:|:|
 Frog   255 VFKNPQNFYMARKGSADVKDMNEKNKVSLLEQSFCGASVIVPELEAALYLKEDGKKSWKKRYFLL 319

  Fly   518 RSSGLYYFPKEKTKNTRDLACLNLFHGHNVYTGLGWRKKWKSPTDYTFGFKAVGDSSLGKSCRSL 582
            |:||:||.||.|||.:|||||...|...|||.|..::.|:|:|||:.|..|   ...:.|..:.:
 Frog   320 RASGIYYVPKGKTKTSRDLACFVQFDNVNVYYGTQYKLKYKAPTDHCFVLK---HPQIQKESQYI 381

  Fly   583 KMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHKSLLEDLCLSRDDAVSQSSFAASMRSESISSISS 647
            |.||.||...|.:|:|.||:.||||.|::::|:           ||.:...|:...:...||:|:
 Frog   382 KYLCCEDPWVLHQWVTGIRIAKYGKVLYENYKA-----------AVQRGGLASHWSTLGSSSVST 435

  Fly   648 AVPSQCGS--VSSAISSMSNSTSGRTSRASSSSSSGCLSDDNNAFDSEFTTGTIKRKPSMKPNLP 710
            |..|..|:  :...::::|:|.|....|          .:||                       
 Frog   436 AAGSSQGNGQICQNVTTISSSFSDAWKR----------GEDN----------------------- 467

  Fly   711 LTTMTRQLKEVGEITICESAGGDASSPERSGTLTRRHSRRKSQESNGSGTLKRRPIAVPVATVVK 775
                                                 ..:||.|.|.|.:....|      ||.|
 Frog   468 -------------------------------------KDKKSSEINKSASKSTTP------TVTK 489

  Fly   776 QTEPMGSASSTSSSSNSTPTPTPSICAKPPPGDSASLMCSSTLSLDSLPPPP--------PPPAL 832
            :..|....:|:.:...:.|...|    ||           ..::.|.:|.||        |||.|
 Frog   490 RPPPAPKRASSINRGTADPACPP----KP-----------KAITTDFMPEPPQFPSPPQFPPPEL 539

  Fly   833 DGSEDQDVYGSQLSLASLPPPPP-----PEDVLAMNYAEPSSPSTPTPMSTPMIMPNSNGSLPPA 892
            ....|:          .||||||     |.|.|        .|..|:.|||.       |:.|| 
 Frog   540 PQPADE----------FLPPPPPDFFDAPPDFL--------PPPPPSFMSTA-------GNPPP- 578

  Fly   893 VPAKPMKPAVKQAAGGLKAAPPYKAPPDYVGPALLPGPPLPPPPPAQKKVSFADSPVLLRRKMCS 957
                   |.|.|......||||               ||.||||||      .:.|.|..:|   
 Frog   579 -------PPVTQLQSSNGAAPP---------------PPPPPPPPA------TNVPPLPVKK--- 612

  Fly   958 PEPVLPQRSPSTTLSCHSSSSAGSAYQTYAPGPMLPPRADVARLSSLSNGSSSEVTSPKRLQESA 1022
             .|..|.:..||.                  |||  |.|:       ::|.            :.
 Frog   613 -HPPNPPKRQSTM------------------GPM--PGAN-------AHGG------------TG 637

  Fly  1023 SNPPRDFLKDLQRVMRKK 1040
            ..|  ||:.||.:.::||
 Frog   638 GQP--DFMSDLMKALQKK 653

Known Domains:


GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 32/87 (37%)
PH_APBB1IP 489..614 CDD:269961 53/127 (42%)
PH 494..605 CDD:278594 49/113 (43%)
apbb1ipNP_001096403.1 UBQ 165..250 CDD:294102 32/85 (38%)
PH_APBB1IP 292..413 CDD:269961 53/124 (43%)
PH 303..404 CDD:278594 48/104 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96337215
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002124
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.700

Return to query results.
Submit another query.