DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and TNRC18

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_016868217.1 Gene:TNRC18 HGNCID:11962 Length:2979 Species:Homo sapiens

Alignment Length:2997 Identity:562/2998 (19%)
Similarity:891/2998 (30%) Gaps:1072/2998 (36%)


  Fly    12 RVQRSTATAAAAAAAAA----------AAATASSTQGKKRPGKQTKASGGGGDEADDKKSASK-- 64
            |.:...|..||:::..|          :|||..      ||.....::..|..||...:|..|  
Human   534 RAEEEAAVVAASSSKKAYLDPGAVLPRSAATCG------RPVADMHSAAHGSGEASAMQSLIKYS 592

  Fly    65 ----TDSAAKKPA----KDPTG------------SSGVSTATT----EGGAGNGGGKQTTSTTTS 105
                .|:.|.:|.    |.|.|            |:|.|.|..    .||...|||:|.......
Human   593 GSFARDAVAVRPGGCGKKSPFGGLGTMKPEPAPTSAGASRAQARLPHSGGPAAGGGRQLKRDPER 657

  Fly   106 STSSTTAPSASASASASNSLKLSP--------EERHEDGKARA------INKMLKSLDIKIHG-- 154
            ..|:.......:.|.....::..|        .::...|..|.      ..:.|...::|.||  
Human   658 PESAKAFGREGSGAQGEAEVRHPPVGIAVAVARQKDSGGSGRLGPGLVDQERSLSLSNVKGHGRA 722

  Fly   155 ----FDNLLPSGEERL--------NDGVLKSS--ISENVKTKSRAAAVKVISSLNPGKM------ 199
                .|:.....||||        .:.:|:.|  :::..:....:.|.   :.|||..|      
Human   723 DEDCVDDRARHREERLLGARLDRDQEKLLRESKELADLARLHPTSCAP---NGLNPNLMVTGGPA 784

  Fly   200 ---------------------------------------PPVKRVRPSP---------------- 209
                                                   ||......:|                
Human   785 LAGSGRWSADPAAHLATHPWLPRSGNASMWLAGHPYGLGPPSLHQGMAPAFPPGLGGSLPSAYQF 849

  Fly   210 --EPVREKVAEKPAEKVLDKEKPKAEQQITPPPAPEESPASKVPKKTVQQAKKAKVESSLVQATV 272
              :|...::...|::. |.......|:...||..|...|..:.|....||.:....:..|.|...
Human   850 VRDPQSGQLVVIPSDH-LPHFAELMERATVPPLWPALYPPGRSPLHHAQQLQLFSQQHFLRQQEF 913

  Fly   273 LTTTSAATSAPSSASTSKHTSTKNPGKKSAHSEQMPKKELSK-LAKMGK-----------PKKEA 325
            |.....|..|.....:::....:.  |...|..:|.:|...: |...||           |:|..
Human   914 LYLQQQAAQALELQRSAQLVQERL--KAQEHRAEMEEKGSKRGLEAAGKAGLATAGPGLLPRKPP 976

  Fly   326 NLVKSTARLPDSNTESVQMELEEIVSTPTVTPTPSATPTATPTPTATPTLTPTPTATRTRTPTPT 390
            .|....|.           ...:.||.|   |:|.|:|.|.........|...........|.  
Human   977 GLAAGPAG-----------TYGKAVSPP---PSPRASPVAALKAKVIQKLEDVSKPPAYAYPA-- 1025

  Fly   391 LTPTPTPTSTPSSTAIAAGQPAPPPPPPGGAPKQRPKVKYTKTSAGSKGRMQQALNQKAPA---A 452
             ||:..|||.|         ||.|||.||...|:.......:       :....|.::||:   |
Human  1026 -TPSSHPTSPP---------PASPPPTPGITRKEEAPENVVE-------KKDLELEKEAPSPFQA 1073

  Fly   453 SWSGAKDIYDFKS----------------------GSEDEEPIKMVLPSLKELREFSDEDNKPLK 495
            .:|.....|.|::                      |...:.|:....|   |....|.|| ||::
Human  1074 LFSDIPPRYPFQALPPHYGRPYPFLLQPTAAADADGLAPDVPLPADGP---ERLALSPED-KPIR 1134

  Fly   496 LFERQAEKTKVQVQDEEEQPLVK-KEEKPPSEKEVKVKSKEKEKEKEKDVDPLSNAQQSEPAAKH 559
            |     ..:|:      .:||.: .||:|.:|:|||.:.::.: |...::.||.:.... |||: 
Human  1135 L-----SPSKI------TEPLREGPEEEPLAEREVKAEVEDMD-EGPTELPPLESPLPL-PAAE- 1185

  Fly   560 TTSTSTTSTTSITSVKKQAKRKIATPMPSSAGRKKKTVGKGKAAAAKEPPPSGSSAESSSSEDER 624
                                 .:|||.|:..      .|.|...|........|.||.|...|  
Human  1186 ---------------------AMATPSPAGG------CGGGLLEAQALSATGQSCAEPSECPD-- 1221

  Fly   625 KLSAYSGPKRHRMASLNALAKVQCLYENESRT-----AHELG-------LSKATQQPPRIRTLDG 677
               ...||:..              .::..||     |.:||       |.:|.::|..:     
Human  1222 ---FVEGPEPR--------------VDSPGRTEPCTAALDLGVQLTPETLVEAKEEPVEV----- 1264

  Fly   678 SDDDNHKDSPRHGDTDRDKGSVSPPHTSAAPP--AAPIAPPKEAEPRRELR--YVPGGRGVGKHW 738
                                .|:.|...|.|.  .|.:| |.|::|..|:.  .||.|.|.....
Human  1265 --------------------PVAVPVVEAVPEEGLAQVA-PSESQPTLEMSDCDVPAGEGQCPSL 1308

  Fly   739 E-------FDSDSETEELQLQQTLPPVK-----------KKKLPKKAP---PKKVASSETDAKRK 782
            |       ..|....||....|.||.::           ..:||:..|   |....:...:....
Human  1309 EPQEAVPVLGSTCFLEEASSDQFLPSLEDPLAGMNALAAAAELPQARPLPSPGAAGAQALEKLEA 1373

  Fly   783 KKSVQVEESD------DEEAKEKEKEKEKPKPPKQLPKKRKTAFTEELIGDYKGILARKRMASLN 841
            .:|:.:|:|.      ..|..|.|.|:.                ::|:.|..:.::||..:.|| 
Human  1374 AESLVLEQSFLHGITLLSEIAELELERR----------------SQEMGGAERALVARPSLESL- 1421

  Fly   842 ASAIVAATYEVERHLD-------KNLA----------------------SDCSSFESYD--ELDT 875
               :.|.::.:...||       |||.                      :..||.|..|  ||| 
Human  1422 ---LAAGSHMLREVLDGPVVDPLKNLRLPRELKPNKKYSWMRKKEERMYAMKSSLEDMDALELD- 1482

  Fly   876 MPTTTSKVTSAAAIKTEVIHIKKEPKESKESLRERERERESERRRE------------------- 921
                         .:..:..::::.||.:..|.:.:|.|:||.|||                   
Human  1483 -------------FRMRLAEVQRQYKEKQRELVKLQRRRDSEDRREEPHRSLARRGPGRPRKRTH 1534

  Fly   922 --------RDNELKDSTVGKMSSHSIIEESND-------SKYSKETKETNTDTTITTTGYRDSAA 971
                    |.......:.||:||.|:: .|:|       .|..|.::|.:  ..:...|......
Human  1535 APSALSPPRKRGKSGHSSGKLSSKSLL-TSDDYELGAGIRKRHKGSEEEH--DALIGMGKARGRN 1596

  Fly   972 STKDAKDCSRPTSSSVVIVQDTDVTITGVYVNASNGAAQEAYCKMQYRVQSSVTEERVLRPGSVE 1036
            .|.|..:.|            :|. |:.:.:.....|:.:.....:.....|:|::..|:     
Human  1597 QTWDEHEAS------------SDF-ISQLKIKKKKMASDQEQLASKLDKALSLTKQDKLK----- 1643

  Fly  1037 PPKSYTPLSALSSMLPPGASSGLSEAHSSPPLPVHAAPTGPHVLLPGEHLSAGMYHAPDLGLHTE 1101
            .|..::..:...|....|....|:                |:..|.|::..|   .|..|||..:
Human  1644 SPFKFSDSAGGKSKTSGGCGRYLT----------------PYDSLLGKNRKA---LAKGLGLSLK 1689

  Fly  1102 HALPDHHGPPPPSYAAAAAAAAAAAAYHAHQLAPGGGGVLHMHHQHQYAAHAAHAHHYQQAAEYH 1166
            .:....|       ..||........:.|.                                   
Human  1690 SSREGKH-------KRAAKTRKMEVGFKAR----------------------------------- 1712

  Fly  1167 GGPPPPPHHYGGPPPQGHYGPPPGAPVPVPVAVPNTVTVPPERCDVGSPPPSYRASAYPPPSSVG 1231
                       |.|...|                     .|...:|.|  .||...:......:.
Human  1713 -----------GQPKSAH---------------------SPFASEVSS--YSYNTDSEEDEEFLK 1743

  Fly  1232 MPPPTLGGGSSAFCAPSPLHHHQHQHQQPGPGVGPPHHDPSGYYQPAGPLISPHVIAAP----PP 1292
            ...|..|..||.. .||.|.....::.:..                .||.::...:|||    |.
Human  1744 DEWPAQGPSSSKL-TPSLLCSMVAKNSKAA----------------GGPKLTKRGLAAPRTLKPK 1791

  Fly  1293 PAQVKK------LQEEDGPVSAAGSPTQLQQQQAAAEAAAAAADQAAAQSQSQSQGQSHGH---A 1348
            ||..:|      |:|.:...|.:.|..:...|..::|     .:....:.:.:.:....|:   |
Human  1792 PATSRKQPFCLLLREAEARSSFSDSSEESFDQDESSE-----EEDEEEELEEEDEASGGGYRLGA 1851

  Fly  1349 HSHAHNPQ------------QAQHPPQPQPYPAGAVAAAAAAAAAHQGVPYSRSMHAAQMHYS-- 1399
            ...|.:|.            .|...|.|...|:.:|....|...|.: ....:|:...:..|:  
Human  1852 RERALSPGLEESGLGLLARFAASALPSPTVGPSLSVVQLEAKQKARK-KEERQSLLGTEFEYTDS 1915

  Fly  1400 --------------------TGYP-PNYYAPYPGEVMCYSPPTYPPYFSSKVYQPSHP------- 1436
                                .|.| |:..||.||               ::...||.|       
Human  1916 ESEVKVRKRSPAGLLRPKKGLGEPGPSLAAPTPG---------------ARGPDPSSPDKAKLAV 1965

  Fly  1437 --AHPAAHPQGPPPPGAYRRYPYYQHAGPPPPHE------------LYE-QQPPPPPVSSGSVSG 1486
              ...|...:||..||.        .|||....:            |:: ....|.|||    :.
Human  1966 EKGRKARKLRGPKEPGF--------EAGPEASDDDLWTRRRSERIFLHDASAAAPAPVS----TA 2018

  Fly  1487 PAQQQPPTSSPASVGAAG----AGTAGAPSGSQLVPA--HQQQHQQQHLEHYPGPPSYYAGYSPG 1545
            ||.:   ||..|..|...    ||.|......:.|||  .:.:|.::            .|...|
Human  2019 PATK---TSRCAKGGPLSPRKDAGRAKDRKDPRKVPATVSKGRHWKK------------KGKEAG 2068

  Fly  1546 GGASAGQCYTRGLQGPYMEYPPQCPCPMPQSCPKNVHTGPHIGSNIISNIDQSSSCSSSMLLSAT 1610
            .||        ||.      ||:.|. :|...     ..||..|                     
Human  2069 PGA--------GLP------PPRAPA-LPSEA-----RAPHASS--------------------- 2092

  Fly  1611 SNSNIGGGSSSSSSSSSSTTLPACSSATTTTTASALTTSRGPVKNVTPNNSNSSGHTS--TNSCR 1673
                                          .||:..:.::...|.|...|....|..|  ..|..
Human  2093 ------------------------------LTAAKRSKAKAKGKEVKKENRGKGGAVSKLMESMA 2127

  Fly  1674 SSNNSNNSSNSSCQTIEMTSWATAATNTTSTTATTATTGTQCQMLVKTELKGE----NPQVTKMQ 1734
            :..:...:.:||....|......|...       ..|...:..::.|.|||..    .|...|:.
Human  2128 AEEDFEPNQDSSFSEDEHLPRGGAVER-------PLTPAPRSCIIDKDELKDGLRVLIPMDDKLL 2185

  Fly  1735 YEAHVMPPPTP--------------PESYCASDEKLLDDQEQEAELELR------LRLGLGLEKS 1779
            |..||....:|              |..||.  |:||    |||.:::|      |..|..: .:
Human  2186 YAGHVQTVHSPDIYRVVVEGERGNRPHIYCL--EQLL----QEAIIDVRPASTRFLPQGTRI-AA 2243

  Fly  1780 HGGQQ--------------------------------------HIEA----YDLTCSTP-PPVTV 1801
            :..||                                      ||..    |.:.|:.| |.:.|
Human  2244 YWSQQYRCLYPGTVVRGLLDLEDDGDLITVEFDDGDTGRIPLSHIRLLPPDYKIQCAEPSPALLV 2308

  Fly  1802 PQAAAVPRKARIGKSMAREMVYAAQQQLLPEKQLKQPKEAAAKLEAEPEMPFVLKAEIKAETKIK 1866
            |.|....||........::...|..:            |..||.......|   .|:.|.:    
Human  2309 PSAKRRSRKTSKDTGEGKDGGTAGSE------------EPGAKARGRGRKP---SAKAKGD---- 2354

  Fly  1867 IEHDGEAQASTHISQLPDLKPTIKTEPEQELEQEAASVPSVAKTEPQP---EVEVEREQQEPPVD 1928
                   :|:|    |.:..||.:. |...|..|.:|.|...|:.|:|   ..:..:.:..||  
Human  2355 -------RAAT----LEEGNPTDEV-PSTPLALEPSSTPGSKKSPPEPVDKRAKAPKARPAPP-- 2405

  Fly  1929 EEQQPTPGGSKQRFNLLALSSGNKKTKTNNSYKSLIKQAEPKSYLCPG-RRFIRRHGRAPAKYVK 1992
               ||:|                               |.|....||. ..|...  .|||..:.
Human  2406 ---QPSP-------------------------------APPAFTSCPAPEPFAEL--PAPATSLA 2434

  Fly  1993 RRQMILTQRQQQRMRLQRREQQQQRRQQREAAAEVVAGAVVTPSLAGNPIEQAGSEVSIVKDQ-- 2055
            ...:|.....:.:.:..|..::...:..|                  .|.|:|  |:.:..|.  
Human  2435 PAPLITMPATRPKPKKARAAEESGAKGPR------------------RPGEEA--ELLVKLDHEG 2479

  Fly  2056 --APNSSATPSASPKRARPRK---QEIAALHLLEGLDTTLSRGYFSDPELNHSSRKQAP---TAV 2112
              :|.|.....|...|..|..   ||..:|         ||.|  |.|....||..:||   ...
Human  2480 VTSPKSKKAKEALLLREDPGAGGWQEPKSL---------LSLG--SYPPAAGSSEPKAPWPKATD 2533

  Fly  2113 GGLYAASSPLTTATDH---------RGKQTTAEK-RSKSETKKPPSGESSESGLPCKKPRKEPAG 2167
            |.|.....|..|..|.         :.:|..||: .|.|.:....|..||.|.....:...|..|
Human  2534 GDLAQEPGPGLTFEDSGNPKSPDKAQAEQDGAEESESSSSSSSGSSSSSSSSSSSGSETEGEEEG 2598

  Fly  2168 KVKGKGKKTTAG----AAATTIASTAETQTEAVNAITASNQETNNNEYQTADLQAQKFRECPAVT 2228
            ...|.|...|.|    ||::..||.|.:.:.:.::.::|:..::::...::...:.......:.:
Human  2599 DKNGDGGCGTGGRNCSAASSRAASPASSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 2663

  Fly  2229 DAKVAGTATSTSTAS------QQQNQQHSDEQHQFLVPSQPATASATAALAA------------- 2274
            .:..:.:::|:|::|      .:.:...||::   ..|:..|..||.|||..             
Human  2664 SSSSSSSSSSSSSSSSSSSTTDEDSSCSSDDE---AAPAPTAGPSAQAALPTKATKQAGKARPSA 2725

  Fly  2275 ------TPPPSRQGQATH-TKRTRSRCKFGNRKRQRHRPGGVSYELDVTQPPATKANVVPKWNNG 2332
                  ||.|..|..... |:..:.:.:.|.:.|.:.|.|   ..|..|:..| |...:|...|.
Human  2726 HSPGKKTPAPQPQAPPPQPTQPLQPKAQAGAKSRPKKREG---VHLPTTKELA-KRQRLPSVENR 2786

  Fly  2333 ------------WMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHVEG-DIIRIRDC-VLLKANEDN 2383
                        |.|.||..|..........|.    |.|:  |.| ::|||.|| |.|.|...|
Human  2787 PKIAAFLPARQLWKWFGKPTQRRGMKGKARKLF----YKAI--VRGKEMIRIGDCAVFLSAGRPN 2845

  Fly  2384 ELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGR------------------------QRND 2424
             |||:.::..:|:: ....|::.:.|:|.||.|..|:                        ||.|
Human  2846 -LPYIGRIQSMWES-WGNNMVVRVKWFYHPEETSPGKQFHQGQHWDQKSSRSLPAALRVSSQRKD 2908

  Fly  2425 CPDE-VYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAE-EDVEDV-----SIVPRRPSIA 2482
            ..:. :|.|.|.|.|.|..|..||.|:...:   |.:.|:..: :|.|.:     :..|....|.
Human  2909 FMERALYQSSHVDENDVQTVSHKCLVVGLEQ---YEQMLKTKKYQDSEGLYYLAGTYEPTTGMIF 2970

  Fly  2483 TAPGFPV 2489
            :..|.||
Human  2971 STDGVPV 2977

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 43/158 (27%)
TNRC18XP_016868217.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.