DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and SHL1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:NP_568053.1 Gene:SHL1 AraportID:AT4G39100 Length:228 Species:Arabidopsis thaliana

Alignment Length:136 Identity:37/137 (27%)
Similarity:62/137 (45%) Gaps:18/137 (13%)


  Fly  2361 MRHVEGDIIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDC 2425
            ::|:... |:..|.||::::|..:..|||:|..:..:.......:.:.||||||.:..||::...
plant    16 LKHINKS-IQEGDAVLMRSSEPGKPSYVARVEAIETDARGSHAKVRVRWYYRPEESIGGRRQFHG 79

  Fly  2426 PDEVYASRHRDHNSVACVEDKCYVLTFSEY------------CRYRRRLRAAEEDVEDVSI---- 2474
            ..||:.|.|.|..|...:|.||.|.:||.|            ||:.........|.:.|::    
plant    80 AKEVFLSDHFDFQSADTIEGKCKVHSFSSYTKLDSVGNDDFFCRFEYNSTTGAFDPDRVTVFCKC 144

  Fly  2475 -VPRRP 2479
             :|..|
plant   145 EMPYNP 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 36/132 (27%)
SHL1NP_568053.1 BAH 23..157 CDD:295389 36/129 (28%)
PHD_SF 141..187 CDD:304600 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124254
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
21.910

Return to query results.
Submit another query.