DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and EBS

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:NP_001320030.1 Gene:EBS AraportID:AT4G22140 Length:234 Species:Arabidopsis thaliana

Alignment Length:182 Identity:46/183 (25%)
Similarity:73/183 (40%) Gaps:36/183 (20%)


  Fly  2368 IIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYAS 2432
            ::|..||||::.::..:.||||:|..:..:..: .:.:...||||||.:..||::.....|::.|
plant    30 VVRAGDCVLMRPSDAGKPPYVARVEKIEADARN-NVKVHCRWYYRPEESLGGRRQFHGAKELFLS 93

  Fly  2433 RHRDHNSVACVEDKCYVLTFSE------------YCRYRRRLRAAEEDVEDVSIVPRRPSIATAP 2485
            .|.|..|...:|.||.|.||..            |||:..:....       :..|.|.::....
plant    94 DHFDVQSAHTIEGKCIVHTFKNYTRLENVGAEDYYCRFEYKAATG-------AFTPDRVAVYCKC 151

  Fly  2486 GFPVRTVPEHTNPELVMF----CRRAYE-----FRTRRLLKLPHKNGLVCSS 2528
            ..|.       ||:.:|.    |:..|.     .......||.|.....|||
plant   152 EMPY-------NPDDLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCAECSS 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 42/172 (24%)
EBSNP_001320030.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124254
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.