DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and AT4G04260

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:NP_001328826.1 Gene:AT4G04260 AraportID:AT4G04260 Length:206 Species:Arabidopsis thaliana

Alignment Length:85 Identity:29/86 (34%)
Similarity:46/86 (53%) Gaps:1/86 (1%)


  Fly  2373 DCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDH 2437
            ||||::.::..:.||||:|..:..:..: .:.:...|||.||.:..||::.....|::.|.|.|.
plant    10 DCVLMRPSDAGKAPYVARVEKIEADARN-NVKVHCRWYYCPEESHGGRRQLHGAKELFLSDHFDV 73

  Fly  2438 NSVACVEDKCYVLTFSEYCR 2457
            .|...:|.||.|.||..|.|
plant    74 QSAHTIEGKCIVHTFKNYTR 93

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 29/86 (34%)
AT4G04260NP_001328826.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124254
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.