DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and bahcc1b

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_009305095.1 Gene:bahcc1b ZFINID:ZDB-GENE-100716-2 Length:2688 Species:Danio rerio

Alignment Length:3132 Identity:560/3133 (18%)
Similarity:936/3133 (30%) Gaps:1122/3133 (36%)


  Fly    14 QRSTATAAAAAAAAAAAATASSTQGKKRPGKQTKASGGGGDEADDKKSASKTDSAAKKPAKDPTG 78
            :|......||:....|..|.....|..:|||.                   ..|....|....:|
Zfish    15 ERGALVHRAASRITPAGHTTVQHPGHFQPGKY-------------------YPSHIPMPPHSGSG 60

  Fly    79 SSGVSTATTEG---GAGNGGGKQTTSTTTSSTSS--------TTAPS--------------ASAS 118
            ..|.|:|:..|   .:..|......|...||.||        :||||              ..:.
Zfish    61 LIGNSSASFMGTFLASSLGSPPSHPSGPPSSPSSPPYRSGPHSTAPSQIWFPHSHEAPGYPRFSG 125

  Fly   119 ASASNSLKLSPEERHEDGKARAINKMLKSLDIKIHGFDNLLPSGEERLNDGVLKSSISENVKTKS 183
            :.|...|.:||.:.|  |.:..:....:..|.:...:...|||....|       |.:.::...|
Zfish   126 SLAPTFLPMSPLDHH--GNSSVLYGQHRFYDTQKDFYLRSLPSQPHLL-------SANHSLPPLS 181

  Fly   184 RAAAVKVISSLNPGKMPPVKRVRPSPEPVREK------VAEKPA-----EKVLDKEKPKAEQQIT 237
            |.|....:.|.:        |.|.....|.:|      |||:..     ||...|::.|.::...
Zfish   182 RTAPAHPLDSCS--------REREPGSTVSQKSSKETGVAERRVGPGGKEKEKSKQESKQDRHHG 238

  Fly   238 PPPA-------PEESPASKVPKKTVQQAKKAKVESSLVQATVLTTTSAATSAPSSASTSKHTSTK 295
            ||..       |:..|      :.::...:.|.:...:.:.:|:|.:...|.|.:|:.....|..
Zfish   239 PPTLHHHHQHHPQHHP------QGLEDDFRHKDDPKHLSSCLLSTKTQNGSDPGAATRGSLPSCV 297

  Fly   296 NP-------GKKSAHSEQMPKKELSKLAKMGKPKKEANLVKSTARLPDSNTESVQMELEEIVSTP 353
            .|       |::::......|:.:|...::.:|..:.  ::.:|.|..::            ..|
Zfish   298 GPGASSLGTGRQTSGDSHCCKEGVSGEMRISEPASDC--LRHSAMLGHAH------------PMP 348

  Fly   354 TVTPTPSATPTAT---------------------------PTPTATPTLTPTPTATRTRTPTPTL 391
            ...|.|....:|.                           |.|...||.........:....||.
Zfish   349 YSMPPPLGLGSAVGGSWLHPNHPHHHHPHHPHAELFCPPPPAPLTMPTAQEKSLGRDSEVTGPTF 413

  Fly   392 TPTPTPTSTPSS----------TAIAAGQPAPPPPPPGGAPKQRPKVKYTKTSAGSKGRMQQALN 446
            .|:..|.....|          ..:..|..|     .||             |||.:        
Zfish   414 VPSVGPLGDKISGPFQLGNHHCRGVGGGMIA-----VGG-------------SAGKE-------- 452

  Fly   447 QKAPAASWSGAKDIYDFKSGSEDEEPIKMVLPSLKELREFSDEDNKPLKLFERQAEKTKVQVQDE 511
            .|.|..|.||::              ...:||                        :...|.:..
Zfish   453 TKTPERSSSGSR--------------AANLLP------------------------QNSCQRKSS 479

  Fly   512 EEQPLVKKEEKPPSEKEVKVKSKEKEKEKEKDVDPLSNAQQSEPAAKHTTSTSTTSTTSITSVKK 576
            ::|....|.:|.|                  |..|..:.:.:|........|.:..:.|:.|.::
Zfish   480 QQQHAYGKADKSP------------------DWPPGPHLRTNEVQHSQNQHTHSARSCSLDSSEE 526

  Fly   577 QAKRKIATPMPSSAGRKKKTVGKGKAAAAKEPPPSGSSAESSSSEDERKLSAYSGPKRHRMASLN 641
            ....:.:.|..:..|.:.|:     :..|..||....|              :|||.....:...
Zfish   527 SDAFRPSLPQGTKGGHQAKS-----SIYASTPPFRDCS--------------HSGPSNRASSEGK 572

  Fly   642 ALAKVQCLYENESRTA---HELGLSKATQQPPRI---------RTLD-------------GS--- 678
            ...:|:|..::..|.|   |:...:....|.|.:         |.:|             |:   
Zfish   573 GATEVECTQKSSQRVARIRHQQHRASTGGQGPEMEPNSTTQDKRKMDMESASQGYGGNRTGTHPS 637

  Fly   679 ----------DDDNHKDSPRHG---DTDR-DKGSVSPPHTSAAPPAAPIAP--PKEAEPRRELRY 727
                      |::.||.....|   .|.| |:|.: ||.|  ||..|.:.|  |:....|..::|
Zfish   638 WEVRGPQPRPDEEPHKAYNSLGAASQTSRVDQGPL-PPLT--APQEATLGPQGPESNAMRNLMKY 699

  Fly   728 VP------------GGRG-------VGKHWE----FDSDSETEELQLQ---QTLPPVKKKKLPKK 766
            ..            ||.|       .|:..|    .|.........||   |||||         
Zfish   700 SSQQPLLFTQKSPFGGLGCLKQGAVAGERSERNERSDKSGNGSSCALQEGKQTLPP--------- 755

  Fly   767 APPKKVASSETDAKRKKKSVQVEESDDEEAKEKEKEKEKP-----------KPPKQLPKKRKT-A 819
                :.|||..:.:|.::    ...|..||:.:.:.::.|           :||.:||....| :
Zfish   756 ----RRASSSGENERSER----VGKDSGEAQGEGEVRQPPVGIAVAVARQREPPCRLPDGHPTHS 812

  Fly   820 FTEELIGDYKGILARKRMASLNASAIVAATYEVERHLDKNLASDCSSFESYDELDTMPTTTSKVT 884
            ....::...||              |....|.:||.:|:.                         
Zfish   813 HHSRVMPSMKG--------------IGHPMYPLEREMDEE------------------------- 838

  Fly   885 SAAAIKTEVIHIKKEPKESKESLRERERERESERRRERDN------ELKDSTVGKMSSHSIIEES 943
                        :|...|.:..|...:||||...|..:|.      ....|..|.::||.|:...
Zfish   839 ------------RKRVCEEQLGLSPFDRERELLLRENKDRVEFARIHPSSSCHGDLTSHLIVPGG 891

  Fly   944 NDSKYSKETKETNTDTTITTTGYRDSAASTKDAKDCSRPTSSSVVIVQDTDVTITGVYVNASNGA 1008
            :.                  .|...||.:..........|.|            ..:::..|.|.
Zfish   892 SQ------------------LGTEPSAHAHPTHHHWMPRTGS------------PSLWMGHSYGL 926

  Fly  1009 AQEAYCKMQYRVQSSVTEERVLRPGSVEPPKSYTPLSALSSMLPPGASSGLSEAHSSPPLPVHAA 1073
            :.                                  :||...|.||.|:.: .:...|.||:...
Zfish   927 SH----------------------------------AALHQNLTPGFSTTM-PSPLQPVLPLPQD 956

  Fly  1074 PTGPHVLLPGEHLSAGMYHAPDLGLHTEHALPDHHGPPPPSYAAAAAAAAAAAAYHAHQLAPGGG 1138
            |:...|:||.|.::....|..|        :.:..|..||.|.|.                   |
Zfish   957 PSAALVVLPTEPVAHPATHHLD--------VMEQQGLWPPVYGAR-------------------G 994

  Fly  1139 GVLHMHH-------------------QHQYAAH-------AAHAHHYQQ-------------AAE 1164
            ...||.|                   |||:..|       .||.|.:.|             .:|
Zfish   995 PTSHMQHPAVYSRSQFLRQQELYALQQHQHQQHRAAQAMELAHRHSHSQRKPEDPPIDLVEGPSE 1059

  Fly  1165 YHG-----------GPPPPPHHY--GG-----------PPPQGHYGPPPGAPVPVP---VAVPNT 1202
            .|.           .|.|||...  ||           |.|:.|....|..|.|.|   ||.|.:
Zfish  1060 PHAPKHTKPFSVGPSPKPPPSSSSPGGCASRLSPCCRSPAPRSHLKSTPCTPCPEPSPAVAAPRS 1124

  Fly  1203 VTVPP--------------ERCDVGSPPPSYRASAYP--PPSSVGMPPPTLGGGSSAFCAPSP-- 1249
            ..:.|              ::...|.||..|..|..|  ||   |...|.:..|...  .|||  
Zfish  1125 PALSPHSTPHHLPKPAESQDKRGEGQPPQDYPQSLEPDLPP---GYTYPAIAMGYKG--GPSPQE 1184

  Fly  1250 ---LHHHQHQHQQPGPGVGPPHHDPSGYYQPAGPLISPHVIAAPPPPAQVKK----------LQE 1301
               ..|...:.:|..|....|...|   ..|.|.  .|........|.::.|          :.|
Zfish  1185 VQLAEHADLEAEQAEPAEPAPRPHP---LSPKGE--EPVCHTGVGSPIRISKEIEDVEEEGGVIE 1244

  Fly  1302 EDGPVSAAGSPTQLQQQQAAAEAAAAAA----DQAAAQSQSQSQG-------------------- 1342
            |||.|........|.|......:..:.|    |:|.|...||:.|                    
Zfish  1245 EDGQVDEGQVDATLSQTSLCPTSDTSVAEPFSDKATAIPNSQTCGIVSPAPAEENNERDMDLQVP 1309

  Fly  1343 --------QSHGHAHSHAHN-----------PQQAQHPP-QPQP--------YPAGAV-----AA 1374
                    |:........|:           |..:..|| .|.|        ||...:     ..
Zfish  1310 MIAPLTTTQNLQSVEPTKHDLDRTVEDGCTPPTNSSTPPLSPCPVPSDLGNQYPGSCIWSLELLI 1374

  Fly  1375 AAAAAAAHQGVPYSRSMHAAQMHYSTGYPPNYYAPYPG-------------------------EV 1414
            |||..|...          |:|..|.....|..||..|                         ::
Zfish  1375 AAALCATRD----------ARMAMSVPVSGNAVAPNYGIELLSELAELEQSQQQRNNTGENDDDM 1429

  Fly  1415 MCYSPPTYPPYFSSKVYQ--PSHPAH------------------PAAHPQGPPP----------- 1448
            :.:...:.....:::..:  |..||.                  |.:.|..|..           
Zfish  1430 LTFDLQSLATLAAARALELAPPIPADSTPPLRRILNLRKKCKWTPRSEPVCPVKATMETLDQEEL 1494

  Fly  1449 ------PGAYRRYPYYQH--AGPPPPHELYEQQPPPPPVSSG--------SVSGPAQQQP-PTSS 1496
                  ....|||...|.  |.....|:..:::....|...|        |.|.|    | ||.:
Zfish  1495 AMRVRLAELQRRYKEKQRELAKLQRKHDHQKEETARSPARRGPGRPRKRKSTSAP----PIPTDA 1555

  Fly  1497 PASVGAAGAGTA-GAPSGSQLVPAHQQQHQQQHLEHYPGPPSYY-------AGYSPGG------- 1546
            |..|.:||||.. |..:...|.....::.:::.:   .|.|.::       |...|.|       
Zfish  1556 PKKVKSAGAGAGPGLMTAEDLAGGGDRKRKKKRM---TGGPYHHLTSTQMKAHCRPRGRPRLLST 1617

  Fly  1547 -----GASAGQCYTRGLQGP-------YMEYPPQCPCPMPQSCPKNVHTGPHIGSNIISNIDQSS 1599
                 ..|..:...:..:|.       :.|...|...|..||..:.     |..:|.......::
Zfish  1618 KFKQKACSQLKQKAKAKRGSRLVNLLCHRESKTQSTVPEHQSAKEE-----HAHNNKTGEQGDTA 1677

  Fly  1600 SCSSSMLLSATSNSNIGGGSSSSSSSSSSTTLPA------CSSATTTTTASALTTSRGPVKNVTP 1658
            ...:::...:....::....:.|.:..|||.||.      |::|.|.:...|  |.:|    ::.
Zfish  1678 GSGTAVQQDSDGKRSVMKRGARSKAILSSTPLPTRTQQLLCNTAMTDSKLEA--TEKG----ISD 1736

  Fly  1659 NNSNSSG-HTSTNSCRSSNNSNNSSN-------SSCQTIEMTSWATAATNTTSTTATTATTGTQC 1715
            ......| :.|........|.::...       |.|..:::.:...|..                
Zfish  1737 TEEEDDGIYDSEEGAEGIKNLSSKEQLSGAGRPSQCSIVKLEANQKAKN---------------- 1785

  Fly  1716 QMLVKTELKG---ENPQVTKMQYEAHVMPPPTPPESYCASDEKLLDDQEQEAELELRLRLGLGLE 1777
                |||.:|   .|..|||.:.:..  ..|..|...||      |....|.:.:.||   .|.:
Zfish  1786 ----KTERQGFGSMNVSVTKEEMKRR--KAPCRPAQVCA------DHNHSELDEDRRL---TGPK 1835

  Fly  1778 KSHGGQQHIEAYD-----LTCSTPPPVTVPQAAAV--PRKA-----------------RI----- 1813
            ...|.:::  .:|     .|..||...|..::|.:  .||:                 ||     
Zfish  1836 WREGSREN--TFDHTRVLKTSPTPRERTTRKSAVLLGKRKSCWLQALSSQYDDISWSRRIRNKQQ 1898

  Fly  1814 --GKSMAREM-VYAAQQ--QLLPEKQLKQPKEAAAKLEAEPEM---------PFVLKAEIKAE-T 1863
              |::::|.: .:||.:  |:..:....:.:|...:.|.|||:         ..:|..||..: .
Zfish  1899 AKGRAVSRLLESFAADEGFQIDDDSSFSEGEEEEEEEEEEPELMGSALPALPNCILTKEILRDGL 1963

  Fly  1864 KIKIEHDGEA--QASTHISQLPDLKPTIKTEPEQELEQEAASVPSV---------AKTEPQPE-V 1916
            |:.|..:.|.  .|..|...|||:...:       :|.|..:.|.:         |..:.||| |
Zfish  1964 KVLISKEDELLYAAYVHTLDLPDIYSVV-------VEGERGNRPRIYSLEQLLQEAVLDVQPETV 2021

  Fly  1917 EV------------ERE--------QQEPPVDEEQQPTPGGSKQRFNLLALSSGNKKTKTNNSYK 1961
            |.            ||.        ::..|.:|:::    ||.    ::....|::...:.:|.:
Zfish  2022 ETLMAGTRVCAYWSERSRCLYPGYVRRGGPGEEQKE----GSV----MVEFDDGDRGWISLSSIR 2078

  Fly  1962 SL-----IKQAEPKSYLCPGRRFIRRHGRAPAKYVK---RRQMILTQRQQQRMRLQRREQQQQRR 2018
            .|     :..|||                :||..:.   ||:...||.:    ..|:.:...:|.
Zfish  2079 CLPPGYQVHCAEP----------------SPAHLISPSCRRRKTSTQEK----ITQQADASNERS 2123

  Fly  2019 QQREAAAEVVAGAVVTPSLAGNPIEQAGSEVSIVKDQAPNSSATPSASPKRARP----------- 2072
            ...|.....|......|. :.|...::|:..::.:..:|..| .|.|:..|.:|           
Zfish  2124 SNTEPRKSAVKAKPGRPK-SVNASSKSGASENVTETASPLLS-WPVATMSRRKPSMDLFQFNGLT 2186

  Fly  2073 ----RKQEIAALHLLEGLDTTLSRGYFS------------------------------------- 2096
                :.:|.....||....||.::|.||                                     
Zfish  2187 KKALKGKESDMFPLLSSTMTTPAKGIFSTSFEVDSFSSIANGCTSFGNQQLAPGLPPSHKVVPGS 2251

  Fly  2097 -----------------------------------DPELNHSSRKQAPTAVGGLYAASSPLTTAT 2126
                                               :|||..|.|.:......|:    ..||:..
Zfish  2252 RCRKIGDRKEFLVKLDHEGVTSPKTKNGKALLLLGNPELQRSGRMEKGFGAKGI----GELTSTM 2312

  Fly  2127 DHR--------GKQTTAE-KRSKSETKKPPSG----ESSESGLPC-----------------KKP 2161
            .:.        .|:.:.. .:..|:.:|.|.|    |.::.|..|                 ::.
Zfish  2313 GYSQSVLLVKDAKRNSCHLLKGSSDMRKHPQGLGLSEYTDYGPNCHSDCLSSYSDMDEDEDEEED 2377

  Fly  2162 RKEPAGKVKGKGKKTTAGAAATTIASTAETQTEAVNAITASNQETNNNEYQTADLQAQKFRECPA 2226
            .:..|.:..|:.....:.:::::.:|:|.:.....::...|:.  |::.|.:.:.:|.:.     
Zfish  2378 ARRAAMRTTGRFLSRLSVSSSSSGSSSASSSGSLSSSSVCSSD--NDSSYSSDEEEASRL----- 2435

  Fly  2227 VTDAKVAGTATSTSTASQQQNQQHSD-----EQHQFLVPSQPATASATAALAAT-PPPSRQGQAT 2285
                .:.|..:|..|..||  |||||     .:|.|...:...:.|..|..::| .||.|:..|.
Zfish  2436 ----LLQGCLSSHHTLLQQ--QQHSDPPTAPPRHTFGAKTMSISNSKAAVNSSTGKPPKRKEIAN 2494

  Fly  2286 HTKRTRSRCKFGNRKRQRHRPGGVSYELDVTQPPATKANVVPKWNNGWMWAGKAFQGAVFLNSDD 2350
            .:...:|:......|:|:         :..::.|...:..:| ....|.|:|...|.........
Zfish  2495 SSSVVQSKSSKDFPKKQK---------MQSSEGPPNSSAFMP-GRQLWRWSGNPTQRRGLKGKAR 2549

  Fly  2351 PLVLRTCYPAMRHVEG-DIIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPE 2414
            .|.    |.|:  |.| |.:|:.||.:..:.....||::.::..||:: ....|::.:.|:|.||
Zfish  2550 KLF----YKAI--VRGKDTVRVGDCAVFLSAGRPHLPFIGRIESLWES-WSSNMVVKVKWFYHPE 2607

  Fly  2415 HTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVSIV---- 2475
            .|..|::..|....:|.|.|.|.|.|..:..||.|::.:||.|. .|:|....:.:|:..:    
Zfish  2608 ETKLGKRHRDGKHALYQSSHEDENDVQTISHKCQVVSRAEYERL-SRIRKPNSNGQDLYYLAGTY 2671

  Fly  2476 -PRRPSIATAPG 2486
             |....:.||.|
Zfish  2672 DPTSGQLVTAEG 2683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 36/128 (28%)
bahcc1bXP_009305095.1 BAH_BAHCC1 2560..2680 CDD:240065 32/122 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.