DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and BAHCC1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:NP_001278253.1 Gene:BAHCC1 HGNCID:29279 Length:2639 Species:Homo sapiens

Alignment Length:3011 Identity:564/3012 (19%)
Similarity:870/3012 (29%) Gaps:1098/3012 (36%)


  Fly   182 KSRAAAVKVISSLNPGKMPPVK----RVRPSPEPVREKVAEKPAEKVLDKEKPKAEQQITPPPAP 242
            :|.|||.: ::...|...||..    :..|||.|:....|   :.:::.                
Human    22 RSAAAAAR-LAPAGPAAQPPAHFQPGKYFPSPLPMASHTA---SSRLMG---------------- 66

  Fly   243 EESPASKVPKKTVQQAKKAKVESSLVQATVLTTTSAATSAPSSASTSKHTSTKNPGKKSAHSEQM 307
             .||||..        ..:.:.|||..|.....:..::|.|..|....|.:|....  .:||.:.
Human    67 -SSPASSF--------MGSFLTSSLGSAASTHPSGPSSSPPEQAYRGSHPTTSQIW--FSHSHEA 120

  Fly   308 PKKELSKLAKMGKPKKEANLVKSTARLPDSNTE---------------SVQMELEEIVSTPTVTP 357
            |          |.|:...:|  ::..||.|:.:               ..|.:...:.:.|    
Human   121 P----------GYPRFSGSL--ASTFLPVSHLDHHGNSNVLYGQHRFYGTQKDNFYLRNLP---- 169

  Fly   358 TPSATPTATPTPTATPTLTPTPTATRTRTPTPTLTPTPTPTSTPSSTAIAAGQPAPPPPPPGGAP 422
                     |.||..|.....|:..|                            |.|..|.|...
Human   170 ---------PQPTLLPANHNFPSVAR----------------------------AAPAHPMGSCS 197

  Fly   423 KQRPKVKYTKTSAGSKGRMQQALNQKAPAASWSGAKDIYDFKSGSEDEEPIKMVLPSLKELREFS 487
            :.|.:        |..|.:|:            |.||...|..|.|                   
Human   198 RDRDR--------GEAGSLQK------------GPKDFDRFLVGKE------------------- 223

  Fly   488 DEDNKPLKLFERQAEKTKVQVQDEEEQPLVKKEEKPPSEKEVKVKSKEKEKEKEKDVDPL---SN 549
                    |...:|.|.            .:.:|:|.:|       ::..||:.|.|.|:   .:
Human   224 --------LGREKAGKA------------AEGKERPAAE-------EDGGKERHKLVLPVPADGH 261

  Fly   550 AQQSEPA--------AKHTTSTSTTSTTSITSVKKQAKRKIATPMPSSAGRKKKTVGK-GKAAAA 605
            .::..||        .||.||....:......:.:.|....|..|....|....|.|: .|.||.
Human   262 CREGGPAPRGACEGRPKHLTSCLLNTKVLNGEMGRAALASCAGGMLGRPGTGVVTSGRCAKEAAG 326

  Fly   606 KEPPPSGSSAESSSSEDERKL---SAYSGPKRHRMASLNALAKVQC------LYENESRTAHELG 661
               ||....|.|...|..:.|   ::|:||......:..:...:|.      |...:.:...:|.
Human   327 ---PPEPGPAFSECLERRQMLHHTASYAGPPPPLSTAAGSFPCLQLHGGPDGLCPLQDKAPRDLK 388

  Fly   662 LSKATQQPPRIRTLD--------------GSDDDNHKDSPRHGDTDRDKGSVSPPHTSAAPPAAP 712
            .|..|..|......|              |...|.|.:           |:::|.|  |||....
Human   389 ASGPTFVPSVGHLADKGRPFQAAEACAVAGEGKDRHLE-----------GTMAPDH--AAPYGVS 440

  Fly   713 IAPPKEAEPRRELRYVPGGRGVGKHWEFDSDSETEELQ-LQQTLPPVKKKKLPKKAPPK----KV 772
            .|..| ||.:.|.|  |||      :|...:...:.|. |....|......|||....|    ::
Human   441 YAHLK-AEGKGERR--PGG------FEAALNPRLKGLDYLSSAGPEASFPGLPKSGLDKSGYFEL 496

  Fly   773 ASSETDAKRKKKSVQVEESDDEEAK--------EKEKEKEKPKPPKQLPKKRKTAFTEELIG--- 826
            .:|..|..|.      ...|....|        :|...||.|..|....|..:....:.|:.   
Human   497 PTSSQDCARP------GHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQKVARIRHQQHLMAAEV 555

  Fly   827 DYKGILARKRMASLNASAI-----------------VAATYEVERHLDKNLASDCSSFESY---- 870
            :..||.|..:..||..:::                 .|.....||.....|....|..:..    
Human   556 EQGGIGAEAKRKSLELASLGYSGPHLPPWGVQAGQGTAMAISEERKAGAYLDPFGSGLQQAALLP 620

  Fly   871 DELDTMPTTTS------KVTSAAAI---KTEVIHI----------------KKEPKESKESLRER 910
            .||...|...|      |.:|.|.:   |..::.:                .|.|.:|:.....|
Human   621 QELPAPPDEVSAMKNLLKYSSQALVVGQKAPLVGLGGLKASCIQQEAKFLSSKGPGQSERPDCAR 685

  Fly   911 ERERESERRRERDNELKDSTVGKMSSHSIIEESNDSKYSKETKETNTDTTITTT-------GYRD 968
            .||.::   ...|.|::...||  .:.::..:.:....|:....|||.......       |.|.
Human   686 SREHDT---THGDGEVRQPPVG--IAVALARQKDTVSRSEAAYGTNTARQGRAAPAFKGGGGPRS 745

  Fly   969 SAASTKDAK-------DCSRPTSSSVVIVQDTDVTITGVYVNASNGAAQEAYCKMQYRVQSSVTE 1026
            :.|...:|:       |.....:|..:::||:...:....::..:..                  
Human   746 THALDLEAEEERTRLCDDRLGLASRELLLQDSKDRVEFARIHPPSSC------------------ 792

  Fly  1027 ERVLRPGSVEP------------------------PKSYTPL------------SALSSMLPPG- 1054
                 ||.:.|                        |::.:|.            .||...|||| 
Human   793 -----PGDLAPHLMMQSGQLGGDPAPHTHPHPPWLPRTRSPSLWMGGHSYGLGHPALHQNLPPGF 852

  Fly  1055 ASSGLSEAHSSPPLPVHAAPTGPHVLLPGEHLSAGMYHAPDLGLHTEHALPDHHGPP---PPSYA 1116
            .:|......|..||| ..||| ..|:||.|...   :.||       |||.|.....   ||.|.
Human   853 PASVAGPVPSVFPLP-QDAPT-QLVILPSEPTP---HSAP-------HALADVMDQASLWPPMYG 905

  Fly  1117 AAAAAAAAAAAYHAHQLAPGGGGVLHMHHQHQYAAHA---------AHAHHYQQAAEYHGGP--- 1169
                               |.|...||.|..|...::         .:|...|:||::...|   
Human   906 -------------------GRGPASHMQHPGQLPVYSRPQLLRQQELYALQQQRAAQFQRKPEDQ 951

  Fly  1170 --------------------------PPPPHHYGGP---PPQGH---YGPPPGAPVPVP-VAVPN 1201
                                      |..|....||   ||..|   ..||..:|.|.| .:.|.
Human   952 HLDLEEPAQEKAPKSTHKPVALTPTAPGAPSPAAGPTKLPPCCHPPDPKPPASSPTPPPRPSAPC 1016

  Fly  1202 TVTVPPERCDVGSPPPSYR--------------------------------------ASAYPPPS 1228
            |:.|    |...||.|..|                                      ||..|..|
Human  1017 TLNV----CPASSPGPGSRVRSAEEKNGEGQQSTADIITSEPVARAHSVAHAGLEFLASNDPSTS 1077

  Fly  1229 S------VGMPP----PTLGGGSSAFCAPSPLHHHQHQH----QQPGPGVGPPHHDPSGYYQPAG 1279
            :      ..:||    |..|.|   |..||.:|....:.    |...||..|   :|:..:.|..
Human  1078 ASQSFGITDLPPGYLRPMAGLG---FSLPSDVHSSNLEDPETMQTTAPGAQP---EPTRTFLPGE 1136

  Fly  1280 P-------LISPHVI-----------AAPPP-----------PAQVKKLQE-------------- 1301
            |       |..|.::           |.|.|           |:.::.|||              
Human  1137 PPPCSPRSLEEPGLLSGAREATQDLAATPYPTERGPQGKAADPSPLEGLQELQCAALLEAGGPEA 1201

  Fly  1302 --------------------EDGPVSA---------AGSPTQLQQ--QQAAAEAAAAAADQAAAQ 1335
                                |.||.|.         ||||..|:.  :|.|.|......|:...|
Human  1202 TGQAHSTQGGAREERSREEGEQGPSSGASSQVLEQRAGSPGALEDEGEQPAPEEDELEEDELGQQ 1266

  Fly  1336 SQSQSQGQSHGHAHSHAHNPQ------------------QAQHPPQPQPYPAGAVAAAAAAAAAH 1382
            |...|: :..|.|..::|.|:                  .:..||.|||       .||:...:.
Human  1267 SMEDSE-EDCGGAPDNSHPPRALPGLDALVAATINLGDLPSDSPPDPQP-------PAASGPPST 1323

  Fly  1383 QGVPYSRSMH------------------------------------------------AAQMHYS 1399
            ..:|:|..:|                                                ||.:..|
Human  1324 VPLPHSSGIHGIALLSELADLAIQRQRSERTVPEEEEDVLAFNLQHLATLATAWSLVEAAGLDSS 1388

  Fly  1400 T--GYPPNYYAPYPGEVM-----------CYSPPTYP--PY------------------------ 1425
            |  ..||. ..|..|..:           .::|.|.|  |.                        
Human  1389 TAPAQPPT-ANPCSGPRLTPRMQILQRKDTWTPKTKPVCPLKAAIDRLDTQEVGMRVRLAELQRR 1452

  Fly  1426 FSSKVYQ-----------------------PSHP-------AHPAAHPQGPPP------------ 1448
            :..|..:                       |..|       :.||..|.||.|            
Human  1453 YKEKQRELARLQRKHDHERDESSRSPARRGPGRPRKRKHSSSLPAPRPTGPLPRSDGKKVKAVRT 1517

  Fly  1449 ----------------PGAYRR------YPYYQHA----------------GPPPPHELYEQQPP 1475
                            |...|.      |...|.|                .|...|.:  .|..
Human  1518 SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRV--AQLK 1580

  Fly  1476 PPPVSSGSVSGPAQQQPPTSSPA-----------SVGAAGAGTAGAPSGSQLVPAHQQQHQQQHL 1529
            |...|.|..:|.:..|...::|.           |...:||.....|.|          |..:..
Human  1581 PKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAKSAKVSGATRHPQPKG----------HGSRET 1635

  Fly  1530 EHYPGPPSYYAGYSPGGGASAGQCYTRGLQGPYMEYPPQCPCPMPQSCPKNVHTGPHIGSNIISN 1594
            ...|..||..|....|.|..:..|  .||.|  .|.|       |:.....:|||..:..     
Human  1636 PRCPAQPSVAASQEAGSGYDSEDC--EGLLG--TEAP-------PREAGLLLHTGASVAV----- 1684

  Fly  1595 IDQSSSCSSSMLLSATSNSN--------IGGGSSSSSSSSSSTTLPACSSATTTTT--------- 1642
              ...|.||.:.:.|...:.        :|....||..|.......:..:...||.         
Human  1685 --LGPSPSSVVKMEANQKAKKKKERQGLLGACRLSSPESEVKIKRRSVKAKVGTTLERAPGQRPP 1747

  Fly  1643 -ASALTTSRGPVK-------NVTPNNSNSSGHTSTNSCRSSNNSNNSSNSSCQTIEMTSWATAAT 1699
             |.....::|..|       ..||:.......:...:||...:...|......|.:.|.......
Human  1748 GALGKKKAKGKAKGSLRAEPGATPSRDALFNPSRAFACREEGSQLASERLKRATRKGTVLQPVLR 1812

  Fly  1700 NTTSTTATTATTGTQCQMLVKTELKGENPQVTKMQYEA----------HVMPPPTPPESYCASDE 1754
            ......:.|..|.....:|      |:..:::|::::|          .::      ||:...::
Human  1813 RKNGALSITLATRNAKAIL------GKGRKLSKVKHKAGKQGKGRAVSRLL------ESFAVEED 1865

  Fly  1755 KLLDD-----QEQEAELELRLRLGLGLEKSHGGQQHIEAYDLTCSTPPPVTVPQAAAVPRKARIG 1814
            ...||     :|:|.|.|         |:...|               |::..|:||:.|...|.
Human  1866 FEFDDNSSFSEEEEDEEE---------EEEDSG---------------PLSAEQSAALARSCAIH 1906

  Fly  1815 KSMARE-----------MVYAA---------------------QQQLLPEKQLKQPKEAAAKLEA 1847
            |...|:           ::||.                     :|::...:||.|    .|.|:.
Human  1907 KEDLRDGLPVLIPKEDSLLYAGSVRTLQPPDIYSIVIEGERGNRQRIYSLEQLLQ----EAVLDV 1967

  Fly  1848 EPEMPFVLKA---------------------------EIKAETKIKIEHDGEAQASTHISQLPDL 1885
            .|:....|..                           |.:....:.:|.|........:|.:..|
Human  1968 RPQSSRYLPPGTRVCAYWSQKSRCLYPGNVVRGASGDEDEDLDSVVVEFDDGDTGHIAVSNVRLL 2032

  Fly  1886 KPTIK---TEPEQEL--EQEAASVPSVAKTEPQPEVEVEREQQEPPVDEEQQPTPGGSKQRFNLL 1945
            .|..|   |||...|  .........|:...|.|.     |...|.:..:.|..|...|      
Human  2033 PPDFKIQCTEPSPALLVSSSCRRTKKVSSEAPPPS-----EAATPSLSPKAQDGPEALK------ 2086

  Fly  1946 ALSSGNKKTKTNNSYKSLIKQAEPKSYLCPGRRFIRRHGR-----APAKYVKRRQMILTQRQQQR 2005
              :.|.|....:.:.|:.:..:..||.......|:.|.|.     :.....||:.:....:....
Human  2087 --TPGKKSISKDKAGKAELLTSGAKSPTGASDHFLGRRGSPLLSWSAVAQTKRKAVAAASKGPGV 2149

  Fly  2006 MR-LQRREQQQQRRQQREAAAEVVAGAVVTPSLAGNPIEQAGSEVSIVKDQAPNSSAT----PSA 2065
            :: |.:.....::.:.|||...|  .:|.|| :.||.. :|.|..|:....||....|    |..
Human  2150 LQNLFQLNGSSKKLRAREALFPV--HSVATP-IFGNGF-RADSFSSLASSYAPFVGGTGPGLPRG 2210

  Fly  2066 SPKRARPRKQEIAALHLLEGLDTTLSRGYFSDPELNHSSRKQAPTAVGGLYAASSPLTTATDHRG 2130
            :.|..|.:|.|                            |.:|..  ||...|........||.|
Human  2211 AHKLLRAKKAE----------------------------RVEAEK--GGRRRAGGEFLVKLDHEG 2245

  Fly  2131 KQTTAEKRSKSETKKPPSGE---SSESGLPCKKPR-KEPAGKVKGKGKKTTA-------GAAATT 2184
            ..:...|..|:..    .|:   |.:.|.|...|. ..||  :.||.||..|       |.|...
Human  2246 VTSPKNKTCKALL----MGDKDFSPKLGRPLPSPSYVHPA--LVGKDKKGRAPIPPLPMGLALRK 2304

  Fly  2185 IASTAETQTEAVNAITASNQETNNNEYQTADLQAQKFRECPAVTDAKVAGTATSTSTAS------ 2243
            .|..||......:...:|..:.:.:....|.....:|....:|:.:. :|::||:|:.|      
Human  2305 YAGQAEFPLPYDSDCHSSFSDEDEDGPGLAAGVPSRFLARLSVSSSS-SGSSTSSSSGSVSTSSL 2368

  Fly  2244 ----QQQNQQHSDEQHQFLVPSQPATASATAALAATPPPSR-QGQATHTKRTR---SRCKF---- 2296
                .:.:...||::...|: .|.........|.|.|...| :|...|....|   ||...    
Human  2369 CSSDNEDSSYSSDDEDPALL-LQTCLTHPVPTLLAQPEALRSKGSGPHAHAQRCFLSRATVAGTG 2432

  Fly  2297 ------GNRKRQRHRPGGVSY----ELDVTQPPATKANVVPKWN------NGWMWAGKAFQGAVF 2345
                  .:.|.:..|...:|:    ||...|.|.:..| .||.:      ..|.|:|...|....
Human  2433 AGSGPSSSSKSKLKRKEALSFSKAKELSRRQRPPSVEN-RPKISAFLPARQLWKWSGNPTQRRGM 2496

  Fly  2346 LNSDDPLVLRTCYPAMRHVEG-DIIRIRDC-VLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLL 2408
            ......|.    |.|:  |.| :.:|:.|| |.|.|...| |||:.::..:|:: ....|::.:.
Human  2497 KGKARKLF----YKAI--VRGEETLRVGDCAVFLSAGRPN-LPYIGRIESMWES-WGSNMVVKVK 2553

  Fly  2409 WYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVS 2473
            |:|.||.|..|:::.|..:.:|.|.|.|.|.|..:..||.|:...:|.:..|..:.  :|.:|:.
Human  2554 WFYHPEETKLGKRQCDGKNALYQSCHEDENDVQTISHKCQVVAREQYEQMARSRKC--QDRQDLY 2616

  Fly  2474 IV-----PRRPSIATAPGFPV 2489
            .:     |....:.||.|.|:
Human  2617 YLAGTYDPTTGRLVTADGVPI 2637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 38/132 (29%)
BAHCC1NP_001278253.1 Atrophin-1 <850..1253 CDD:331285 94/444 (21%)
BAH_BAHCC1 2512..2631 CDD:240065 33/123 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.