DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and bahd1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_021323119.1 Gene:bahd1 ZFINID:ZDB-GENE-120411-42 Length:848 Species:Danio rerio

Alignment Length:795 Identity:195/796 (24%)
Similarity:313/796 (39%) Gaps:211/796 (27%)


  Fly  1855 LKAEIK---------------------AETKIKIEHDGEAQASTHISQLPDLKPTIKTEPEQ--- 1895
            :||::|                     :|.|.|::.|..|..:..|           .||.|   
Zfish   130 MKAQVKEMQGKSKICKCRKKACKSCKASEPKSKVKPDKSALYTEFI-----------LEPRQRRL 183

  Fly  1896 -ELEQEAASVPSVAKTEPQPEVEVEREQQEPPVDE--------------------------EQQP 1933
             .|..||.:...:.:.:||...:..::||:...|.                          |.:|
Zfish   184 ASLNAEAVNSLLLDRVDPQQTSKPSKKQQQTKGDPSLSKDTAKDNDCPRKSQDNRKRGCTGETEP 248

  Fly  1934 TPGGSKQR-----FNLLALSSGNKKTKTNNSYKSLIKQAEPKSYLCPGRRFIRRHGRAPAKYVKR 1993
            .....|.:     .:|..|:|...|.....:..:|:|.....|   .|:|..:..|:..|..|:.
Zfish   249 NRNPKKAKTESDTIDLQTLNSPAPKRLAGLNAAALLKLTSTSS---AGKRRGKTEGKPSAGGVRG 310

  Fly  1994 RQMILTQRQQQR----MRLQRREQQ-----QQRRQQREAAAEVVAGA--VVTP-----SLAGNPI 2042
            :|::...|:||.    ....:..||     ::.....||..:...|:  .::|     |:.|.|:
Zfish   311 KQLLSKSRKQQHNLACQSTLKVSQQCCSFCEKHALHNEALWDGSTGSHGFISPGYQCRSMLGFPL 375

  Fly  2043 EQAGSEVSIVKDQAPNSSATP--SASPKRARPRKQEIAALHLLEG------LDTTLSRGYFSDPE 2099
            :.       ||::...:....  ..|.:|:......:|   |..|      .|....:|:...|.
Zfish   376 KP-------VKEEKTETDVKSYYCCSQERSVEYCHRLA---LFLGQKPFPETDEHSLKGFLPSPH 430

  Fly  2100 -LNHSSRKQAPTAVG--------GLYAASSPLTTATDHRGKQTTAEKRSKSETKKPPSG----ES 2151
             |.||:     ..:|        |.|...:       |.|  |.:...|.::...|||.    :.
Zfish   431 TLTHSA-----MPIGAHPYPCYPGYYVHIA-------HHG--TPSLPVSSNQGSHPPSSVPPLKM 481

  Fly  2152 SESGLPCKKPRKEPAGKVKGKGKKTTAGAAATTIASTAETQTEAVNAITASNQETNNNEYQTADL 2216
            ..||:  ::|:..|                     ||....|...:....::..|...|  ...|
Zfish   482 CSSGV--QRPKLLP---------------------STVSHPTGIPHPAYCNSVGTCYGE--ACRL 521

  Fly  2217 QAQKFRECPAVTDAKVAGTATSTSTASQQQNQQHS----DEQHQFLVPSQPATASATAALAATPP 2277
            .:..:|....:|....:..|..:|...:.:.:.:|    |......:||  |...:...:::.||
Zfish   522 SSYAYRPTQPITSRGCSYNAGCSSCMHKMETEDYSYPLDDRSSSITMPS--ALPLSICPISSVPP 584

  Fly  2278 PSR-----QGQATHTKRTRSRCKFGNRKRQRHRP---------------------------GGVS 2310
            |::     |.....|.|::.:.:.|....||.:|                           .|.:
Zfish   585 PTQSVPHLQTPLPDTGRSQVQIRVGRECPQRAKPPSGSRSGVRDSAVCPHIKDGQLGSGHGSGAA 649

  Fly  2311 YELDVTQPPATKANVVPKWNNGWMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHVEGDIIRIRDCV 2375
            .:..:::..||         |||:..|.|.:..||:.::|...||.||..::. :|::||:||.|
Zfish   650 KQSKISRRRAT---------NGWLPVGVATEKEVFIVAEDSASLRRCYEGVQR-DGEVIRVRDTV 704

  Fly  2376 LLKAN-EDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGR-QRNDCPDEVYASRHRDHN 2438
            ||::. ....|||||||:..|.:||.||:||||.||||||||..|| ....|.:|::||||:|.|
Zfish   705 LLRSGPRKKSLPYVAKVSAFWDDPESGELMMSLFWYYRPEHTQGGRIPSMHCENEIFASRHQDEN 769

  Fly  2439 SVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVS-IVPRRPSIATAPGFPVRTVPEHTNPELVM 2502
            ||||:||||||||.::|||:...::..||.....| :||  ||....|..  |.||...:|:||.
Zfish   770 SVACIEDKCYVLTLAQYCRFCALVKCREEGFPKRSPLVP--PSSYVIPAH--RCVPNDIDPDLVF 830

  Fly  2503 FCRRAYEFRTRRLLK 2517
            .||..|:||..||||
Zfish   831 VCRHVYDFRYGRLLK 845

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 80/156 (51%)
bahd1XP_021323119.1 BAH_BAHCC1 695..803 CDD:240065 59/108 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005597
OrthoInspector 1 1.000 T597843
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46576
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5045
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.