DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and tnrc18

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_005164235.1 Gene:tnrc18 ZFINID:ZDB-GENE-100326-1 Length:2936 Species:Danio rerio

Alignment Length:3357 Identity:598/3358 (18%)
Similarity:966/3358 (29%) Gaps:1389/3358 (41%)


  Fly    76 PTGSSGVSTATTEG---------GAGNGGGKQTTSTTTS-----STSSTTAPSASA--------S 118
            |..|..:..|...|         |||:.....|....:|     |..|...|.||:        :
Zfish    24 PMESHRLGAAAAAGRIPPSPGHLGAGHPAALHTGKYLSSAMNLHSHHSDAFPGASSPFLGGYVGA 88

  Fly   119 ASASNSLKLSPEERHEDGKARAINKMLKSLDI-------KIHGFDNL---------LPSG---EE 164
            :||..|         .|...||.|:  .||.:       ...||.:|         :|.|   ..
Zfish    89 SSAHGS---------SDPAFRAPNQ--ASLQMAQLWASHSHEGFSHLPSSLYPSPYIPLGHLEHP 142

  Fly   165 RLNDGVLKSSISENV----KTKSRAAAVKVISSLNPG-------KMPPVKRVRPSPEPVREKVAE 218
            :|:...|..|..|..    ...|::|..:...:..||       .:||.|   .|.|..|:...|
Zfish   143 QLSQHALFDSQKEGFYLPGSVHSQSAMARSPVAHMPGSFSRERESLPPHK---SSKESSRDVGKE 204

  Fly   219 KPAEKVLDKEKPKAEQQITPPPAPEESPASKV-------------------PKKTVQQAKKAKVE 264
            ||.:..|....|:.|::   .|..|..|.|.|                   |.||.:.|:....:
Zfish   205 KPCKSDLAHSLPRKERE---KPKEESRPHSVVDLTLDLKAEDERRVGNLERPAKTTEHARPFFHQ 266

  Fly   265 SSLVQATVLTTTSA----------ATSAPSSASTSKHTSTKNPGKKSAHSEQMPKKELSKLAKMG 319
            .|    ..|:.|..          ..|..||.:.::|.||:...:........|...||.    .
Zfish   267 HS----PALSNTDTKPKQTNHSLLGNSGTSSGTPTRHQSTEQDRRDRDDETIRPGGHLSN----D 323

  Fly   320 KPKKEANLVKSTARLPDSNTESVQMELEEIVSTPTVTPTPSATPTATPTPTATPTLTPTPTATRT 384
            |.|:..::..|...|..|           ..|..::.|:||..|         |.|..:.|.   
Zfish   324 KQKRCDSVATSAGTLHVS-----------YASPSSLQPSPSHLP---------PRLVSSGTY--- 365

  Fly   385 RTPTPTLTPTPTPTSTPSSTAIAAGQPAPPPPPPGGAPKQRPKVKYTKTSAGSKGRMQQALNQKA 449
                                          |||....|...|....||    ..|:..:.:    
Zfish   366 ------------------------------PPPHHMPPSMYPLYSTTK----EPGKEHRVI---- 392

  Fly   450 PAASWSGAKDIYDFKSGSEDEEPIKMVLPSLKELREFSDEDNKPLKLFERQAEKTKVQVQDEEEQ 514
             |.::..:.::||.:.|     ||::...:         .|||..|..||::.::.:|:.:  |:
Zfish   393 -APTYVPSVEVYDERKG-----PIQIASQA---------RDNKNDKSRERESHRSALQLGN--ER 440

  Fly   515 PLVK------KEEKPPSEKEVK----------VKSKEKEKEKEKDVDPLSNAQQSEPAAK---HT 560
            .|:.      :.|.|| ..:||          ::|.....:|...::..:|...:.|.|:   :|
Zfish   441 TLMDHGRSSVRSESPP-HGDVKRDILREEGSIIRSNGLAMKKPLHLEMCTNKSGNSPDARDLTNT 504

  Fly   561 TSTSTTSTTSITSVKKQAKRKIATPMPSSAG----------RKKKTVGKGKAAAAKEPPPSGSSA 615
            ||.....|...|..:.|.:.::.....|.:|          ...||:  |.|....:|...|:.|
Zfish   505 TSKHMIRTGLETESRSQERDRVQRSTHSFSGMDPSSLHTEQHPLKTL--GSAEPKWKPFEMGNYA 567

  Fly   616 ES------------SSSEDE------------RKLSAYSGPKRH-RMASLNALAKVQCLYENESR 655
            .|            :..|:|            |.:.:...|..| .::::.:|.|....:.:|| 
Zfish   568 TSHMAALAAQHNHGARGEEEGKQMYLDTTSLHRPVGSSGSPDGHGEVSAMQSLIKYSGNFSSES- 631

  Fly   656 TAHELGLSKATQQPPRIRTLDGSDDDNHKDSPRHGDTDRDKGSVSPPHTSAAPPAAPIAPPKEAE 720
                                 ||         |||...|                :|.       
Zfish   632 ---------------------GS---------RHGSDSR----------------SPF------- 643

  Fly   721 PRRELRYVPGGRGVGKHWEFDSDSETEELQLQQTLPPVKK-KKLPKKAPPKKVASSETDAKRKKK 784
                     ||.|              .|:|:...|.|.: :.||.:.|.|::       |::.:
Zfish   644 ---------GGLG--------------SLKLEAGYPGVSRVQHLPPQQPGKQL-------KKEPE 678

  Fly   785 SVQVEESDDEEAKEKEKEKEKPKPPKQLPKKRKTAFTEELIGDYKGILARKRMASLNASAIVAAT 849
            ..:..:|...:....:.|.|...||                                    |...
Zfish   679 RPESAKSFGRDGSSSQGEAEVRHPP------------------------------------VGIA 707

  Fly   850 YEVERHLDKNLASDCSSFESYDELDTMPTTTSKVTSAAAIKTEVIHIKKEPKESKESLRERERER 914
            ..|.|..|.  :|..||....|.    |.....:  ...|.||.....:.|:...|.|.....||
Zfish   708 VAVARQRDN--SSKSSSASDRDR----PLLGGPI--KGPIHTEEEQGDERPRHRDERLLSGRVER 764

  Fly   915 ESERRRERDNELKDSTVGKMSSHSIIEESNDSKYSKETKETNTDTTITTTGYRDSAASTKDAKD- 978
            |.|:....:.||.|.|               ..:......:..:..:..||....|.:.:...| 
Zfish   765 EQEKVLRENKELADYT---------------QLHPPMVSASGLNPNLMVTGGPTLAGAGRWPADP 814

  Fly   979 ---------CSRPTSSSVVIVQDTDVTITGVYVNASNGAAQEAYCKMQYRVQSSVTEERVLRPGS 1034
                     .|||.:.|             ::::.|                          |..
Zfish   815 ASHLASHPWLSRPGAPS-------------MWLSGS--------------------------PYG 840

  Fly  1035 VEPPKSYTPLSALSSMLPPGASSGLSEAHSSPPLPVHAA---PTGPHVLLPGEHLSAGMYHAPDL 1096
            :.||       :|...||||....|:   .|.|.|...|   .||..|::|.|||.         
Zfish   841 LGPP-------SLHQALPPGYPPALT---GSIPPPYQFARDPQTGQVVVIPTEHLP--------- 886

  Fly  1097 GLHTEHALPDHHGPP------PPSYAAAAAAAAAAAAYHAHQLAPGGGGVLHMHHQHQYAAHAAH 1155
              |....|  ..|||      ||         |.::..|||||.       .:.||.....|..:
Zfish   887 --HYAEML--ERGPPLWSAMYPP---------AGSSLQHAHQLQ-------LLSHQQLLRQHELY 931

  Fly  1156 AHHYQ--------------------------------QAAEYHGGP----PPPPHHYGGPPPQGH 1184
            ...:|                                :|||.|...    |....|...|||   
Zfish   932 MIQHQTAQVMELQRNAQLVERLNASQPRTDLDEKLDKRAAEVHKSSLSCIPTTTLHSRKPPP--- 993

  Fly  1185 YGPPPG-------APVPVPVAVPNTVTV--PPERCDV--GSPPPSYRASAYPPPSSVGMPPPTLG 1238
            ..|.|.       .|:||| .:|:.||.  ..||..|  ..|...|...:.|.|.|:        
Zfish   994 CSPTPSTSYSKALTPLPVP-PLPSPVTALKSEERPKVEKSLPQQPYSHPSSPAPHSI-------- 1049

  Fly  1239 GGSSAFCAPSPLHHHQHQHQ------------QPGPGVGPP---HHDPSGY-YQ----PAGP--- 1280
              |.|..:|||....:.:.:            |..|....|   ...|.|| ||    |.|.   
Zfish  1050 --SPASASPSPTSSIRTKEESVEVSEKEPLSLQKQPSTTFPSIYREIPPGYPYQSITAPFGSHYP 1112

  Fly  1281 -LISPHVIA-----AP--PPPAQ---------------------VKKLQ--EEDGPVSAAGSPTQ 1314
             |:.|...|     ||  |.||:                     |:.||  .|..|:...|| |.
Zfish  1113 YLLQPAAAADADGLAPDVPLPAETSEHLAIAADVKPQHLCSPVLVEPLQTSREPEPMEEEGS-TV 1176

  Fly  1315 LQQQQAAAEAAAAAADQAAAQSQ-SQSQGQSHGHAHSHAHNPQQAQHPPQPQP----------YP 1368
            .:::....:....:...|...:| |.:......|..:.| .|...:.|.|...          |.
Zfish  1177 FKKEPNLEDLKDDSIRLAPIITQDSSTPTDPEAHPRTIA-TPSPEEDPEQEHGEDIKIKRTSLYE 1240

  Fly  1369 AGAV----AAAAAAAAAHQG-VPYSRSMHAAQMHYSTGYPPNYYAPYPGEVMCYSPPTYPPYFSS 1428
            ...:    :|:.....|..| |.|..|...:..|.               |:|...||..|    
Zfish  1241 TSRLDVERSASTETTDASTGLVDYKSSSSYSDTHL---------------VVCDVQPTKQP---- 1286

  Fly  1429 KVYQPSHPAHPAAHPQGPPPPGAYRRYP----YYQHAGPP--PPHE----LYEQQP--------- 1474
              ...|...:||......|....:....    :..::|||  ||..    :..:.|         
Zfish  1287 --LDLSDSLNPADLRDAVPDSSTHLESKLDNLFLPNSGPPHLPPSSAAVAILPEDPMAGMFALVT 1349

  Fly  1475 -------------------------PPPPVSSGSVSGPA----------QQQP------------ 1492
                                     ...|:.|.::.|.|          |:||            
Zfish  1350 ASELPQAGAMSILTDACSSRSELCTDVSPLESTALEGMALLSQMAELEMQRQPRDDTQAVIFCGL 1414

  Fly  1493 -------------------------------------------PTSSPASVGAAGAGTAGAPSGS 1514
                                                       |..|.:|:  .|...|......
Zfish  1415 ESLLEAGRQVLLEAIECEPQVIIRLPRELNPNKKYSWRQKKDEPMFSKSSL--EGMDAAEVDYRV 1477

  Fly  1515 QLVPAHQ---------------------QQHQQQHLEHY----------PG-------------P 1535
            :|....|                     :|.||||::..          ||             |
Zfish  1478 RLAELQQRYKEKQRELVKLQRRRDKEEKRQQQQQHIQQQERNRSLARRGPGRPRKRKHGLCALSP 1542

  Fly  1536 PS--------------YYAGYSPGG--------------------GASAGQCYTRGLQGPYMEYP 1566
            ||              .|:..|..|                    |:||.:     |:.....:.
Zfish  1543 PSSKLDSRCAKLSRSVLYSEDSESGEVLRKRFRASNRDEEEEEEDGSSALK-----LKKKKKSWG 1602

  Fly  1567 PQCPCPMPQSCPKNVHTGPHIG---------SNIISNIDQSSSCSSSMLLSATSNSNIGGGSSSS 1622
            .|      ::|....|..|.:.         ..:.|.:|::.|.:.....|..|...|.|.|..|
Zfish  1603 EQ------EACSSFSHEVPKMAVKKSRVSEQEQLASKLDKALSLTKLNKFSKPSCKFIDGSSGKS 1661

  Fly  1623 SSSSSS-----TTLPA------------------------CSSATTTTTASALTTSRG------- 1651
            ..||.|     |.|..                        ..:|..|..:.|....:|       
Zfish  1662 RPSSGSRVPMLTDLDVRVKMGKSSLSKDLGIFQKTSKGGKSKTAAKTKPSEACLKGKGQRKAPYS 1726

  Fly  1652 PVKNVTPNNSNSS----------------------------GHTSTNSCRSSNNSNNSSNSSCQT 1688
            ||::...:.||::                            |..||.|.:..::|..:|:||..:
Zfish  1727 PVRSEISSYSNNTDSEEEDSLKDGWPSSSMLGRTGSHPQLPGLCSTPSKKKRSSSKRASSSSSSS 1791

  Fly  1689 IE--------------------------------------------------------------- 1690
            ::                                                               
Zfish  1792 LKSKQAAKERKHKHFALLLQEAGVSSSEDSFDQEYSTERDDSEDDDEDEDGYDYELDESDGLCSS 1856

  Fly  1691 ---------MTSWATAA------TNTTSTTATTATTGT----QCQMLVKTELK---GENPQVTKM 1733
                     :..:|.:|      ||..|.....|....    :.|.|:.||.:   .|:...|:.
Zfish  1857 SVEESGLGLLARFAASAIPSPIITNPLSLVQLEAKQKAKKKEERQSLLGTEFEFTDSESDVKTRK 1921

  Fly  1734 QY-----------EAHVMPP-------------------PTPPESYC-------ASDEK------ 1755
            ::           |..::||                   |..|..:.       :.||:      
Zfish  1922 KFPSLLHGKRSAPELPLLPPASVMRDDSSPTKRGRKPKKPKSPREFSFDLTADGSEDEQWTRRRS 1986

  Fly  1756 ---LLDDQEQEAELELRLRLGLGLE-----------------------KSHGGQQHIEAYDLTCS 1794
               .|.|..|...:....:..|.|.                       |....::.|:...| |.
Zfish  1987 ERIFLHDAAQSTPISPSSKTPLPLTPKPARGPKTSPQSPKELVKAKEVKDPSKKKRIKETPL-CL 2050

  Fly  1795 TPPPV-TVPQ--AAAVP----RKARIGKSMAREMV------------------------YAAQQQ 1828
            .||.: :.|.  :.|:|    ||.::.|..|||.:                        .||.:.
Zfish  2051 PPPQLSSTPSETSGALPVSPGRKNKVQKPKAREELGQNVLEFPQQARGKGGAVSKLMESMAADED 2115

  Fly  1829 LLPEKQLKQPKEAAAKLEAEPEMP--------FVLKAEIKAETKIKIEHDGEAQASTHISQL--P 1883
            ..|.:.....::....:.|:||.|        .:.|.|::...::.|..|.:...:.|:|.:  |
Zfish  2116 FEPNQDSSFSEDENPSVSAQPERPCTPAPRNCVINKDELQDGLRVLIPMDDKLLYAGHVSTVHSP 2180

  Fly  1884 DL-----------------------------KP---------------------------TIKTE 1892
            |:                             ||                           .::..
Zfish  2181 DIYSVVVEGERGNRPHIYCLEQLLQEAIIDVKPPSVRYLPQGTRIAAYWSQQYRCLYPGTVVRGS 2245

  Fly  1893 PEQELEQEAASV------------------PSVAK---TEPQPEVEV---------------ERE 1921
            |:.|...:..:|                  |:..|   .||.|.:.|               :.:
Zfish  2246 PDMEDVDDLITVEFDDGDTGRIPLSHIRLLPADYKIQCAEPSPALLVASTKRRGRKCSKDVPDGK 2310

  Fly  1922 QQEPPVDEEQQPTPGG----SKQRFNLLALSSGNKK----TKTNNSYKSLIKQAEPKSYLCPGRR 1978
            :..|.:.||..|...|    .|.:....|....::|    |.|....:.|..|   ||...|||:
Zfish  2311 ETPPKITEESAPKSKGRGRKPKPKPEPEAAPKEHEKPDTPTPTQVPERPLSSQ---KSSPRPGRK 2372

  Fly  1979 FIRRHGRAPAKYVKRRQMILTQRQQQRMRLQRREQQQQRRQQREAAAEVVAGAVVTPSLAGNPIE 2043
             |::.|.|...       |....:.|:.....:...:.|.|.:...::.:.|.|::..|...|..
Zfish  2373 -IKQVGTASVS-------IPASNENQKKTTGIKPPAKVRSQPQSVYSQPLYGKVLSVDLYNEPST 2429

  Fly  2044 QAGSEVSIVKDQAPNSSATPSASPKRAR------------------------------------P 2072
            ...|.:|      .|.:::|:...|..:                                    |
Zfish  2430 SLASFIS------NNETSSPTGKGKTVKRLRKPEEEASGFGVKTQRKQPQTEILIKLDHEGVMSP 2488

  Fly  2073 RKQEIAALHLLEGLD--------------TTLSRGYFSDPELNHSSR---KQAPTA-------VG 2113
            :.::..||.::||.:              ||:|.   ::..:...|:   .:.|||       |.
Zfish  2489 KTKKTKALMMMEGQNLSKRENKSVMGVSYTTIST---TEKTIKAKSKPVEAEPPTAESVSTYSVR 2550

  Fly  2114 GLYAASSPLTTATDHRGKQTTAEKR------SKSETKKPPSGESSESGLPCKKPRKEPAGKVKGK 2172
            .|.::|..|...: :.||:   ||:      |.|.:.....||..:.....|||:::.|..:..:
Zfish  2551 KLGSSSEGLMKVS-NSGKK---EKKDLECSSSSSSSSSESDGEEEQGATQEKKPKQDSASSISSR 2611

  Fly  2173 GKKTTAGAAATTIAST-AETQTEAVNAITASNQET--NNNEYQTADLQAQKFRE---CPAVTDAK 2231
            ....|:.:::|:.:|: :.:.:.:.::.|.|::|:  :::|...||.|.....|   .|...|.|
Zfish  2612 ASSPTSSSSSTSSSSSGSHSSSSSSSSSTTSDEESSCSSDEEPVADSQPSPAAEHVASPEEEDVK 2676

  Fly  2232 V-AGTATS------TSTASQQQNQQHSDEQHQFLVPSQPATASATAALAATPPPSRQGQATHTKR 2289
            . :|:|.:      .|:.:||::||.:.::.|            ........|..|:|  .|...
Zfish  2677 AKSGSAPNIHKLQKQSSTTQQRHQQKTPQRQQ------------KVKQGVGRPKRREG--IHLPT 2727

  Fly  2290 TRSRCKFGNRKRQR-----HRPGGVSYELDVTQPPATKANVVPKWNNGWMWAGKAFQGAVFLNSD 2349
            |:...     ||||     :|| .:|..|     ||.:.         |.|.||..|........
Zfish  2728 TKELA-----KRQRLPSVENRP-KISAFL-----PARQL---------WKWFGKPTQRRGMKGKA 2772

  Fly  2350 DPLVLRTCYPAMRHVEGDIIRIRDC-VLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRP 2413
            ..|..:.   .||..|  :|||.|| |.|.|...| ||::..:..:|:: ....|::.:.|:|.|
Zfish  2773 KKLFYKA---IMRGKE--MIRIGDCAVFLSAGRPN-LPFIGHIQSMWES-WGNNMVVRVKWFYHP 2830

  Fly  2414 EHTDQGR------------------------QRNDCPDE-VYASRHRDHNSVACVEDKCYVLTFS 2453
            |.|:.|:                        ||.|..:. :|.|.|.|.|.|..:..||.|::..
Zfish  2831 EETNPGKKLHDKKNWDQMSGQSLPAVLQASNQRKDFMERALYQSSHIDENDVQTISHKCLVVSLE 2895

  Fly  2454 EYCRYRRRLRAAE-EDVEDV-----SIVPRRPSIATAPGFPV 2489
            :   |.:.::..: :|.||:     :..|....|....|.||
Zfish  2896 Q---YEQMIKTKKYQDSEDLYYLAGTYEPTTGMIFNTDGVPV 2934

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 40/157 (25%)
tnrc18XP_005164235.1 BAH_BAHCC1 2784..2928 CDD:240065 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.