DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and wge

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:NP_732790.3 Gene:wge FlyBaseID:FBgn0051151 Length:1669 Species:Drosophila melanogaster

Alignment Length:1926 Identity:366/1927 (19%)
Similarity:589/1927 (31%) Gaps:634/1927 (33%)


  Fly   838 ASLNASAIVAATYEVERHLDKNLAS-----------DCSSFESYDELDTMP-------TTTSKVT 884
            ||.:|:.:::||......|....|:           ....|..:......|       .|.|..|
  Fly     8 ASSSAADVLSATTATATFLVPTTAAVSHPGAHTAHLQLDQFGGFSAATATPLQHHHHQQTNSSYT 72

  Fly   885 SAAAIKTEVIHIKKEPKESKESLRERERERESERRRERDNELKDSTVGKMSSHSIIEESNDSKYS 949
                    .:.||:||.:..|.......:::.:..:...::::..   .:||.|:...|      
  Fly    73 --------FVQIKREPCQVSEISSNNCHQQQQQHHQHHQHQVQHQ---GLSSASMTASS------ 120

  Fly   950 KETKETNTDTTITTTGYRDSAASTKDAKDCSRPTSSSVVI------------------------V 990
                :|.:.:|:||. .:..|.|.| ..:..:.|.:||.|                        :
  Fly   121 ----KTMSSSTLTTL-VKIEAPSPK-VSELEKSTGNSVPIGIAVARKRPQEALVPAINTPATLPL 179

  Fly   991 Q---DTDVTITGVYVNASNGAAQEAYCKMQY--------RVQSSVTEERVLRPGSV-EPPKSY-- 1041
            |   :.|:...|:.| |..||..   |...|        ...::..||..|....| ..|.::  
  Fly   180 QPPLNKDLNCFGIRV-ADLGATS---CGNLYFTGNGDLMTTGTATAEELALSAAGVNRAPSTFWQ 240

  Fly  1042 ----TPLSALSSMLPPGASSGLSEAHSSPPLPVHAAPTGPHVLLPGEHLSAGMYHAPDLGLHTEH 1102
                .|:.::.||.|  |:.||..:..        |..|..||||....:.|:.:.|.|      
  Fly   241 YPNALPIESVISMSP--ATVGLQYSRE--------ASRGQVVLLPAGPTALGISNFPLL------ 289

  Fly  1103 ALPDHHGPPPP-SYAAAAAAAAAAAAYHAHQLAPGGGGVLHMHHQHQYAAHAAHAHHYQQAAEYH 1166
                  .|..| ..||||||....:||.....||||         |..||.||.|          
  Fly   290 ------TPTDPFQQAAAAAAFVWPSAYIPQAPAPGG---------HSAAAAAAAA---------- 329

  Fly  1167 GGPPPPPH-----HYGGPPPQGHYG----PPPGAPVPVPVAVPNTVTVPPERCD----------- 1211
             ...|.|:     ::..|...||..    |...:.:.:.:|...|.|.....|.           
  Fly   330 -SLQPTPNLSSLPNFIFPSMGGHQALSTTPSYASTLQLYLAAAATATGSSTMCQHSNQQTSTTTT 393

  Fly  1212 ---------VGS-----------------------------------------PPPSYRASAYPP 1226
                     .||                                         |||:.....||.
  Fly   394 NSTINLSLAAGSGVTQSGNAASSLSSSSSLSASSSRFLSLATGQTGIPSLLSLPPPTGLKEEYPM 458

  Fly  1227 PSSVGMPP-------------------PTLGGGSSAFCAPSPLHHHQHQHQQPGPGVGPPHHDPS 1272
            |  :.:||                   ||  ..:||...||.|.|            ..|||   
  Fly   459 P--LALPPLVPLEAARDKEQALNLMRLPT--PPTSATMEPSSLGH------------ATPHH--- 504

  Fly  1273 GYYQPAGPLISPHVIAAPPPPAQVKKLQEEDGPVSAAGSPTQLQQQQAAAEAAAAAADQAAAQSQ 1337
             .:| :|.:       |.|.||.:.        :|..|:..:|    .||....|.:|:||...:
  Fly   505 -LFQ-SGAM-------ATPTPALLN--------LSMHGNGGEL----PAATPLPAVSDEAALNYK 548

  Fly  1338 SQSQGQSHGHAHSHAHNPQQAQHPPQPQPYPAGAVAAAAAAAAAHQGVPYSRSMHAAQMHYSTGY 1402
                          .|.|...|.||:....|         .:.:.|.:|..:     .::..|..
  Fly   549 --------------LHAPLTPQTPPRLADIP---------VSGSTQLLPQMQ-----DVNIQTDT 585

  Fly  1403 P--------PNYYAPYPGEVMCYSPPTY-PPYFSSKVYQPSHPAHPAAHPQGPPPPGAYRRYPYY 1458
            |        |....|.......:.|||: .|...:|..:.||......|.|..|..         
  Fly   586 PVCSEDESFPGSAKPQDPAAEAFPPPTHVQPLELTKPSEASHTQPTECHTQTEPSD--------- 641

  Fly  1459 QHAGPPPPHELYEQQPPPPPVSSGSVSGPAQQQPPTSSPASVGAAGAGTAGAPSGSQLVPAHQQQ 1523
               .|....|...:|.||.|:.:.:.:..|.|..|.........:...|...|    ||  ..:|
  Fly   642 ---IPSASQEESAEQTPPEPIETMTQATQADQTSPEDLTGLELLSNISTNSKP----LV--RVKQ 697

  Fly  1524 HQQQHLEHYPGPPSYYAGYSPGGGASAGQCYTRGLQGPYMEYPPQCP----------------CP 1572
            ...:|:|. |.|........|              ..|.:..||...                |.
  Fly   698 EPVEHIEQ-PAPQPQPVNIMP--------------SEPTLPMPPMLEMEPTSEREPLGGLKLLCA 747

  Fly  1573 MPQSCPKNVHTGPHIGSNIISNIDQSSSCSSSMLLSAT--------SNSNIGGGSSSSS---SSS 1626
            :.:   :.:......||::.:.....:...:|:.|..|        :.|....|.|..|   ||:
  Fly   748 LAE---QRIQEEVVQGSSLFATPSSRTPTPTSLALGTTAATPPIFEAKSCYAFGQSQGSVFPSST 809

  Fly  1627 SSTTLPACSSATTTTTASAL-TTSRGPVKNVTP------NNSNSSGHTSTNSCRSSNNSNNSSNS 1684
            ||..:|..|....:.....| |||.|.|..:||      .:|.|||..|..|.|.|..|....:.
  Fly   810 SSFQMPLSSPGFPSMQGIELPTTSAGIVAELTPVKRKKHKHSKSSGSDSRKSARCSKKSKKKRHH 874

  Fly  1685 SCQTIEMTSWATAATNTTSTTATTATTGTQCQMLVKTELKGENPQVTKMQYEAHVMPPPTPPESY 1749
            |.                                            ::.|:.|       |.|  
  Fly   875 SS--------------------------------------------SRQQFSA-------PAE-- 886

  Fly  1750 CASDEKLLDDQEQEAELELRLRLGLGLEKSHG---GQQHIEAYDLTCSTPPPVTVPQAAAVPRKA 1811
              .|..|.|||.|.   |||..|. .::.|:.   ||:.....|.:...       :.|.:.|:.
  Fly   887 --EDLDLQDDQLQS---ELRNALH-AVDPSYAQRFGQEVFSIMDNSMRM-------RLAKITRQY 938

  Fly  1812 RIGK------------------SMAREMVYAAQQQLLPEKQLKQPKEAAAKL--EAEP----EMP 1852
            |..|                  .:..:...|:||.:.|...|:||:...:.:  .:.|    :.|
  Fly   939 RKKKRKLDEISKHKKKKKCSKQQLELQQQQASQQAVQPSSALQQPQMTLSSVLGTSSPLRDYKFP 1003

  Fly  1853 FVLKAEIKAETKIKI---EHDGEAQASTHISQLPDLKPT-----------IKTEPEQELEQEAAS 1903
            ....:.::|.:.::.   .|......|...|| |:..|.           ::.|| ..|:...|.
  Fly  1004 KFSSSNLQASSFLRFPDKTHSFPPPPSLQQSQ-PEPNPLPSSSSPSTSSFVRLEP-SALDAAVAI 1066

  Fly  1904 VPSVAKTEPQ-----PEVEVEREQQEPPVD----EEQQPTPGGSKQRFNL----LALSSGN---K 1952
            .|:.:.|...     .:|...|:|::....    ..:|.....:|:||:.    |.|:|.:   .
  Fly  1067 APTTSSTSTSGSPSTKQVASARKQRKMKASTVGAAGEQTAATEAKRRFSAIDRELQLTSEHLYRD 1131

  Fly  1953 KTKTNNS-----YKSLIKQAEPK---SYLCPGRRFIRRHGRAPAKYVKRRQMILTQRQQQRMRLQ 2009
            :|:....     |..::|...|.   |....|.|..:.|..:....:|...:.:..:..:.:.:.
  Fly  1132 ETRVLTDMGGLFYAGVMKPLRPPDVYSITLDGERGNKSHVMSREDILKDTILEVAPKSVESVPVG 1196

  Fly  2010 RR-----EQQQQRRQQREA--AAEVVAGAVVTPSLAGNPIEQAGSEVSIVKDQAPNSSATPSASP 2067
            .|     .||.:......|  :.:||.|   |.|.|.|....|...||:..|...:         
  Fly  1197 TRLCAYWSQQYRCLYPGRAIDSEQVVDG---TASSATNAATTAPDFVSVEFDDGDS--------- 1249

  Fly  2068 KRARPRKQEIAAL----HLLEGLDTTLSRGYFSDPELNHSSRKQAPTAVGGLYAASSPLTTATDH 2128
              .|.|.|.|..|    .:.|..|..|           :|..||..:|:.|  ..|.|.....||
  Fly  1250 --GRIRLQNIRMLLSDYPIAEYNDNPL-----------YSVGKQKRSALRG--GESGPGGVTQDH 1299

  Fly  2129 RGKQTTAEKRSKSETKKPPSGESSESGLPCKKPRKEPAGKVKGKGKKTTAGAAAT---------- 2183
                           ...|..|.|.|            ....|.....|...|||          
  Fly  1300 ---------------LTVPGCEDSHS------------HHSLGMSSDNTTSLAATMELFTQRSEK 1337

  Fly  2184 -TIASTAETQTEAVNAITASNQETNNNEYQTADLQAQKFRECPAVTDAKVAGTATSTSTAS---- 2243
             .:..:.:..::|.|.::.:. .||..                  .||...|...|...|:    
  Fly  1338 KRLKKSLKKMSKAQNGVSPAT-ATNGG------------------ADAAALGDGVSAEDAARKHH 1383

  Fly  2244 ----QQQNQQH-----SDEQHQFLVPSQPATASATAALAATPPPSRQGQATHTKRTRSRCKFGNR 2299
                ::::::|     |:||.|.:|...    .:.|...||..||.:..:..:.|.:...|....
  Fly  1384 KHKKRKKHKKHHRKNGSEEQEQQVVQQD----YSAAGQEATEAPSTEMSSATSSRVKVEVKVKTE 1444

  Fly  2300 KRQRHRPGGVSYELDVTQPPATKANVVPKWNNG---------------WMWAGKAFQGAVFLNSD 2349
            :.:.......|..:......| |.:.:.:.||.               |.|.|.|::.|..... 
  Fly  1445 QLEMEEEESASNLMSEISDEA-KGDDLVEHNNSKGSSKIAAFLPERQLWGWYGTAYRKAGVKGR- 1507

  Fly  2350 DPLVLRTCYPAMRHVEGDIIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPE 2414
               ..:..|..::..: :.|.:.|..:..:....:.||:.::..:|:. ..|..::.:.|:|.||
  Fly  1508 ---ARKQFYKTIKRGK-ETITVGDSAVFLSTGRPDRPYIGRIESMWET-TTGNKVVRVAWFYHPE 1567

  Fly  2415 HTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEY 2455
            .| .|..:...|..::.|.|.|.|.|..:..:|.||.|..|
  Fly  1568 ET-TGCPKLKFPGALFESPHEDENDVQTISHRCEVLQFGSY 1607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 23/91 (25%)
wgeNP_732790.3 BAH_BAHCC1 1520..1642 CDD:240065 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.