DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and Bahd1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_006224620.1 Gene:Bahd1 RGDID:1563127 Length:781 Species:Rattus norvegicus

Alignment Length:820 Identity:219/821 (27%)
Similarity:311/821 (38%) Gaps:219/821 (27%)


  Fly  1872 EAQASTHISQLPDLK--PTIKTEP----EQELEQEAASVP----------------------SVA 1908
            ::...|....||.|.  ||.:.||    :..:||.|..|.                      |:.
  Rat     8 DSMTHTRRKSLPMLSSGPTGRGEPLQMEDSNVEQGAEDVEPGMPESPGHLTGRRKNYPLRKRSLV 72

  Fly  1909 KTEPQP-EVEVER-----------EQQEPPVDEEQQPTPGGSKQRFNLL-----ALSSGNKKTKT 1956
            ..:|:. :|.:.|           |..|.|.|..:.|:|..|.:...|:     .|:|.|.:...
  Rat    73 PEKPKACKVLLTRLENVAGPRSADEADELPPDLPKAPSPTPSSEDAGLVQPRKRRLASLNAEALN 137

  Fly  1957 NNSYKSLIKQAEPKSYLCPGRR------------------FIRRHGR---------------APA 1988
            |     |:.:.|..|.|...||                  |.::..|               ||.
  Rat   138 N-----LLLEREDTSSLAGARRSRGGDPHRSRDRATGSWSFSKKRPRLGDLGEGSRDLSPELAPD 197

  Fly  1989 KYVKR-------RQMILTQRQQQRMRLQRREQQQQRRQQREA---AAEVVAGAVVTPSLAGN--- 2040
            :..:|       |...|......::..:|....:..|.|.||   :.|.:|..|:.|.:.|.   
  Rat   198 EGARRDGDPAPKRLASLNAAAFLKLSQERELPLRPSRAQAEADGRSTEPLAPKVLRPKVNGKNCP 262

  Fly  2041 PIEQ-AGSEVSIVKDQAPNSSATPSASPKRARPRKQEIAALHLLEGLDTTLSRGYFSDPELNHSS 2104
            .:.| |||..:   ...||....|......|.||...|...|...|            ..|.:..
  Rat   263 KVRQGAGSGEA---TGPPNWQEQPEERWPSAPPRGPPIQPSHQAPG------------KALENPL 312

  Fly  2105 RKQAPTAVGGLYAASSPLTTATDHRGKQTTAEKRSKSETKKP---------PSGESSESGLPCKK 2160
            |...|..:|| .||..|   .....|:::.|.|:...:...|         |...:..|| ||..
  Rat   313 RPNLPLLMGG-QAALKP---EPGRPGEESPAPKQELHQPSFPAPQLAPLPMPGNPADYSG-PCGG 372

  Fly  2161 PRKEPAG-------------------KVKGKGKKTTAGA-------AATTIASTAETQTEAVNAI 2199
            |.....|                   .:..:||.:...|       |.:::.|....|....:|.
  Rat   373 PELTALGGFYLYCGQDGLQCGSYSPCPMLPEGKLSPVAAPNEGLLMAPSSVPSGVPFQHPPWSAS 437

  Fly  2200 T-ASNQETNNNEYQTADLQAQKFRE-------CPAVTDAKVAGTATSTSTASQQQ----NQQH-S 2251
            . .|:::|..|.|....:.......       ||    .|:..||....:..|.:    ...| :
  Rat   438 RYCSSEDTGANGYSICGVLPLSLTHIGTTCGGCP----YKMPFTAEGCRSLGQLEFPLPEAGHPA 498

  Fly  2252 DEQHQFL------VP-------------SQPATASATAALAATPPP-SRQGQATHTKRTRSRCKF 2296
            ...|..|      ||             |:|.|.:.....:|.||. |:.|     .||.|.|:.
  Rat   499 SPAHPLLGCPVPSVPPAAEPIPHLQTPISEPQTVARACPQSAKPPSGSKSG-----LRTGSSCRH 558

  Fly  2297 GNRKRQRHRPGGVSYELDVTQPPATKANVVP-----KWNNGWMWAGKAFQGAVFLNSDDPLVLRT 2356
            ..|.:...||.      ...||.|.:..  |     :..|||:..|.|.:.||::..:....:|.
  Rat   559 TVRSKAARRPS------HPKQPRAQRPR--PRRRRRRRTNGWVPVGAACEKAVYVLDEPEPAIRK 615

  Fly  2357 CYPAM-RHVEGDIIRIRDCVLLKAN-EDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQG 2419
            .|.|: ||  |:.||:||.||||:. .....|||||::.||:|||.||:||||||||||||...|
  Rat   616 SYQAVERH--GETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGG 678

  Fly  2420 R---QRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDV--EDVSIVPRRP 2479
            |   ......:||:||||:|.|||||:|:|||||||:||||:....:...|.:  ...::||...
  Rat   679 RSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGLPSRKTALVPPSA 743

  Fly  2480 SIATAPGFPVRTVPEHTNPELVMFCRRAYEFRTRRLLKLP 2519
            ..:|.|.   |||||.|:||||..||..|:||..|:||.|
  Rat   744 DYSTPPH---RTVPEDTDPELVFLCRHVYDFRHGRILKNP 780

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 82/159 (52%)
Bahd1XP_006224620.1 Patatin_and_cPLA2 <250..363 CDD:299702 29/132 (22%)
BAH_BAHCC1 624..734 CDD:240065 60/110 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005597
OrthoInspector 1 1.000 T1088670
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46576
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.960

Return to query results.
Submit another query.